(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE355

CP001994.PE355       Location/Qualifiers
FT   CDS             complement(377271..378683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0361"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="COGs: COG0034 Glutamine phosphoribosylpyrophosphate
FT                   amidotransferase; InterPro
FT                   IPR000836:IPR000583:IPR002375:IPR005854; KEGG:
FT                   geo:Geob_2890 amidophosphoribosyltransferase; PFAM:
FT                   glutamine amidotransferase class-II;
FT                   phosphoribosyltransferase; SPTR: Q12U32
FT                   Amidophosphoribosyltransferase; TIGRFAM:
FT                   amidophosphoribosyltransferase; PFAM: Phosphoribosyl
FT                   transferase domain; Glutamine amidotransferases class-II;
FT                   TIGRFAM: amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35893"
FT                   /db_xref="GOA:D5E9P2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9P2"
FT                   /protein_id="ADE35893.1"
FT                   /translation="MKEECGVVGVLLDDTKSQSKTAALQIYYSLYALQHRGQESTGITV
FT                   YNGGTTHSMKGMGLVPEVYAREDIAKLIGHVGIGHVRYSTTGHSRIENCQPLIVNYKSG
FT                   TIAIAHNGNLVNGHDLRDELESEGRIFITDSDTEVIAHLLVKELLKHGPVDSIKNVMNR
FT                   LEGSYSLAIMIDDLLIAARDPLGIKPLCIGKTDLGLVVASESVAIDTLNGKLIRDVRPG
FT                   EVVVLKDGEVESHQVYNTTHAAHCVFEYIYFARPDSVIDGQLVYKVRERIGRELAKEHP
FT                   VEADIISPVPDSGITSAVGYTRESGIQYQEGLMKNRYIGRTFILPGQEMRETAVRLKMN
FT                   TIAENIEEKRVVLIDDSVVRGTTSRRIINMIKDAGAREVHARIGSPAIIAPCYMGIDMA
FT                   TRDELIASNNKVENICNTIHADSLGYLSVDGLVRAIGIDKEDLCMGCLTEVYPLEIPGE
FT                   KCQCRQTRLNQF"
     MKEECGVVGV LLDDTKSQSK TAALQIYYSL YALQHRGQES TGITVYNGGT THSMKGMGLV        60
     PEVYAREDIA KLIGHVGIGH VRYSTTGHSR IENCQPLIVN YKSGTIAIAH NGNLVNGHDL       120
     RDELESEGRI FITDSDTEVI AHLLVKELLK HGPVDSIKNV MNRLEGSYSL AIMIDDLLIA       180
     ARDPLGIKPL CIGKTDLGLV VASESVAIDT LNGKLIRDVR PGEVVVLKDG EVESHQVYNT       240
     THAAHCVFEY IYFARPDSVI DGQLVYKVRE RIGRELAKEH PVEADIISPV PDSGITSAVG       300
     YTRESGIQYQ EGLMKNRYIG RTFILPGQEM RETAVRLKMN TIAENIEEKR VVLIDDSVVR       360
     GTTSRRIINM IKDAGAREVH ARIGSPAIIA PCYMGIDMAT RDELIASNNK VENICNTIHA       420
     DSLGYLSVDG LVRAIGIDKE DLCMGCLTEV YPLEIPGEKC QCRQTRLNQF                  470
//

If you have problems or comments...

PBIL Back to PBIL home page