(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE360

CP001994.PE360       Location/Qualifiers
FT   CDS             complement(382705..383226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0366"
FT                   /product="UspA domain protein"
FT                   /note="COGs: COG0589 Universal stress protein UspA and
FT                   related nucleotide-binding protein; InterPro
FT                   IPR006015:IPR006016; KEGG: maq:Maqu_0351 UspA
FT                   domain-containing protein; PFAM: UspA domain protein; SPTR:
FT                   Q12U28 UspA; PFAM: Universal stress protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35898"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9P7"
FT                   /protein_id="ADE35898.1"
FT                   /translation="MVYNTILITTDGSENARKAVQKGIELARACGSKVYALYVMEMNPV
FT                   GITREAIHRDWKTAMQVSLPEHISPAQWREFAKIADENWKIERKKHLEEKAENILSYVE
FT                   ELGKNKDVNVEKVHIEGKPANEILDFASDKKVDLIVMGTLGMGSDGTFRLGRVAERVIH
FT                   NAGCDVMSVR"
     MVYNTILITT DGSENARKAV QKGIELARAC GSKVYALYVM EMNPVGITRE AIHRDWKTAM        60
     QVSLPEHISP AQWREFAKIA DENWKIERKK HLEEKAENIL SYVEELGKNK DVNVEKVHIE       120
     GKPANEILDF ASDKKVDLIV MGTLGMGSDG TFRLGRVAER VIHNAGCDVM SVR              173
//

If you have problems or comments...

PBIL Back to PBIL home page