(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE362

CP001994.PE362       Location/Qualifiers
FT   CDS             complement(386061..386315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35900"
FT                   /db_xref="GOA:D5E9P9"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9P9"
FT                   /protein_id="ADE35900.1"
FT                   /translation="MKKEKSLYRNPYLIAVLYIIAILFLYTVYRDLIAIAVGGIFITIF
FT                   GLMYGVQEHDRDLIYYSGLFLSASIVAIIIAGTFVSLIV"
     MKKEKSLYRN PYLIAVLYII AILFLYTVYR DLIAIAVGGI FITIFGLMYG VQEHDRDLIY        60
     YSGLFLSASI VAIIIAGTFV SLIV                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page