(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE370

CP001994.PE370       Location/Qualifiers
FT   CDS             394275..395564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0376"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: viral A-type inclusion protein; SPTR: Q64B45
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35908"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Q7"
FT                   /protein_id="ADE35908.1"
FT                   /translation="MDFLKKLFGKDRDEPEELHLEFENLFEWSKTRYERQVNAAKPLIS
FT                   DLYSVIDNKLEQLRIDKKAFMAATPIESADKKMGKIADSNRDVIVSNLEILDEKIIVPN
FT                   DNSVEGAYAFYTESVSHLDTFLDNTRKSMLYAKSLYPTEYNKINADLANLNHALSDLFS
FT                   AIEKPRNKLDMINNIFVDVEDIHNLESEIMDCRDKIQELENKYSSLDENVQDAKSDLEK
FT                   LIAGSEYPRAEAINSEIEEVRQQLLNVEADIKRMFTPLSKALSRMQKQDENGIHTLSPQ
FT                   VRNILDIVVNDPVSALDHDLDPLYDELILRLQSDSLGLKDKKKDKTLEQVHSIKNSSSL
FT                   KSLYESKTEYNNILRQLRGQLDQMDVYRQKTSMEKDISKKQEALLSTQDKLEDEKKCLE
FT                   SLEEQLVNAKSKLSSHVNDAFEEDIEIHFR"
     MDFLKKLFGK DRDEPEELHL EFENLFEWSK TRYERQVNAA KPLISDLYSV IDNKLEQLRI        60
     DKKAFMAATP IESADKKMGK IADSNRDVIV SNLEILDEKI IVPNDNSVEG AYAFYTESVS       120
     HLDTFLDNTR KSMLYAKSLY PTEYNKINAD LANLNHALSD LFSAIEKPRN KLDMINNIFV       180
     DVEDIHNLES EIMDCRDKIQ ELENKYSSLD ENVQDAKSDL EKLIAGSEYP RAEAINSEIE       240
     EVRQQLLNVE ADIKRMFTPL SKALSRMQKQ DENGIHTLSP QVRNILDIVV NDPVSALDHD       300
     LDPLYDELIL RLQSDSLGLK DKKKDKTLEQ VHSIKNSSSL KSLYESKTEY NNILRQLRGQ       360
     LDQMDVYRQK TSMEKDISKK QEALLSTQDK LEDEKKCLES LEEQLVNAKS KLSSHVNDAF       420
     EEDIEIHFR                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page