(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE376

CP001994.PE376       Location/Qualifiers
FT   CDS             complement(399872..401065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0382"
FT                   /product="cysteine desulfurase NifS"
FT                   /EC_number="2.8.1.7"
FT                   /note="COGs: COG1104 Cysteine sulfinate
FT                   desulfinase/cysteine desulfurase;
FT                   InterProIPR001597:IPR000192:IPR020578:IPR006025:IPR 017772;
FT                   KEGG: sat:SYN_01251 cysteine desulfurase / selenocysteine
FT                   lyase; PFAM: aminotransferase class V; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; SPTR: A2SQ36
FT                   Aminotransferase, class V; TIGRFAM: cysteine desulfurase
FT                   NifS; PFAM: Aminotransferase class-V; TIGRFAM: cysteine
FT                   desulfurase NifS"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35914"
FT                   /db_xref="GOA:D5E9R3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR017772"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9R3"
FT                   /protein_id="ADE35914.1"
FT                   /translation="MKNNNKNTGNTVYLDHAATTFTDPVVLETMLPYFTENFGNPSSPY
FT                   NIAHISREALDKARQQVADAINADTEEIYFTSGGTESDNWAIKGVAFANRKRGNHIITS
FT                   AIEHHAVLHTCQWLEKQGFEVTYLPVDKYGQVRTEDVKRAIRGDTILISVMLANNEIGT
FT                   IQPIPEIGRIARKKGIYFHTDAVQGIGQIPVDVEALNVDLLSLSSHKFYGPKGVGALYI
FT                   KKGSRIDNHSHGGAQEKKKRAGTENVPGIVGMGAAIEQAISQLEEHAAHMKKLRTRLLE
FT                   GLLQIPATHLAGHPEKRLPNNVNVIFEYIEGESILLMLNSFSIAASTGSACTSASLEPS
FT                   HVLIACGFPHEIAHGSLRLTLGKENTEDDVDYVLQIIEPIIKRLRAMSPMTPEELRK"
     MKNNNKNTGN TVYLDHAATT FTDPVVLETM LPYFTENFGN PSSPYNIAHI SREALDKARQ        60
     QVADAINADT EEIYFTSGGT ESDNWAIKGV AFANRKRGNH IITSAIEHHA VLHTCQWLEK       120
     QGFEVTYLPV DKYGQVRTED VKRAIRGDTI LISVMLANNE IGTIQPIPEI GRIARKKGIY       180
     FHTDAVQGIG QIPVDVEALN VDLLSLSSHK FYGPKGVGAL YIKKGSRIDN HSHGGAQEKK       240
     KRAGTENVPG IVGMGAAIEQ AISQLEEHAA HMKKLRTRLL EGLLQIPATH LAGHPEKRLP       300
     NNVNVIFEYI EGESILLMLN SFSIAASTGS ACTSASLEPS HVLIACGFPH EIAHGSLRLT       360
     LGKENTEDDV DYVLQIIEPI IKRLRAMSPM TPEELRK                                397
//

If you have problems or comments...

PBIL Back to PBIL home page