(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE378

CP001994.PE378       Location/Qualifiers
FT   CDS             401790..403169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0384"
FT                   /product="Sep-tRNA:Cys-tRNA synthase"
FT                   /EC_number="2.5.1.-"
FT                   /note="COGs: COG1103 pyridoxal phosphate-dependent protein;
FT                   InterPro IPR008829:IPR001597:IPR000192:IPR013375; KEGG:
FT                   hha:Hhal_0536 SufS subfamily cysteine desulfurase; PFAM:
FT                   Soluble liver antigen/liver pancreas antigen; aromatic
FT                   amino acid beta-eliminating lyase/threonine aldolase;
FT                   aminotransferase class V; SPTR: B8GHE2 Sep-tRNA; TIGRFAM:
FT                   Sep-tRNA; PFAM: Soluble liver antigen/liver pancreas
FT                   antigen (SLA/LP autoantigen); TIGRFAM: Sep-tRNA:Cys-tRNA
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35916"
FT                   /db_xref="GOA:D5E9R5"
FT                   /db_xref="InterPro:IPR008829"
FT                   /db_xref="InterPro:IPR013375"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9R5"
FT                   /protein_id="ADE35916.1"
FT                   /translation="MKGAKDHLIGKTFEALFELEDMREVIRRSLPTGMSATEETAFMES
FT                   TANLKSVIEDLEKGTSENQTNFPQIVDRIGLRYREEGSINIQPIQAAGRLTPEARKALI
FT                   SYGDGYSTCDSCRKPFRLDKISRPPIADFHEELAGFVNMDTARVVPGARRGFQAVTSSL
FT                   VGKGDSVIVSSLAHYTEFLAVEAAGGKVREIPLDHGNKVDIDSMAEKIEDVIREDGKPP
FT                   SLMMMDHYDYQYANQHDIRSIAKVAHDYDIPVLYNGAYTVGVMPVDAKKLGADFVVGSG
FT                   HKSMASPAPSGILATTDEYSDLVFRTTRMKGDVTGRKFGIKEVEMMGCTLMGGTLLAMM
FT                   ASFPHVKERTQNWDEEVRNSNRFIEEFLKIEGNKVLSEYPRRHTLTKVDTTHTFDKVAK
FT                   EHKRRGFFLSDELSKLGIVGMFPGATRAWKLNTYGLSREKIDYLSDAFKEIAVKYNLNV
FT                   D"
     MKGAKDHLIG KTFEALFELE DMREVIRRSL PTGMSATEET AFMESTANLK SVIEDLEKGT        60
     SENQTNFPQI VDRIGLRYRE EGSINIQPIQ AAGRLTPEAR KALISYGDGY STCDSCRKPF       120
     RLDKISRPPI ADFHEELAGF VNMDTARVVP GARRGFQAVT SSLVGKGDSV IVSSLAHYTE       180
     FLAVEAAGGK VREIPLDHGN KVDIDSMAEK IEDVIREDGK PPSLMMMDHY DYQYANQHDI       240
     RSIAKVAHDY DIPVLYNGAY TVGVMPVDAK KLGADFVVGS GHKSMASPAP SGILATTDEY       300
     SDLVFRTTRM KGDVTGRKFG IKEVEMMGCT LMGGTLLAMM ASFPHVKERT QNWDEEVRNS       360
     NRFIEEFLKI EGNKVLSEYP RRHTLTKVDT THTFDKVAKE HKRRGFFLSD ELSKLGIVGM       420
     FPGATRAWKL NTYGLSREKI DYLSDAFKEI AVKYNLNVD                              459
//

If you have problems or comments...

PBIL Back to PBIL home page