(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE38

CP001994.PE38        Location/Qualifiers
FT   CDS             complement(42076..42387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0039"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nis:NIS_0088 hypothetical protein; SPTR:
FT                   A9A735 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35576"
FT                   /db_xref="GOA:D5E8R7"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8R7"
FT                   /protein_id="ADE35576.1"
FT                   /translation="MNHIVKSAKKTLNALNQSLPVVVGVIMAISLLKAAVPESLYSTIF
FT                   TGNILIDPFIGSLIGSIAAGNPITSYIIGGELIKQGVSLFAVTAFLLSWVTVGIMGEL"
     MNHIVKSAKK TLNALNQSLP VVVGVIMAIS LLKAAVPESL YSTIFTGNIL IDPFIGSLIG        60
     SIAAGNPITS YIIGGELIKQ GVSLFAVTAF LLSWVTVGIM GEL                         103
//

If you have problems or comments...

PBIL Back to PBIL home page