(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE383

CP001994.PE383       Location/Qualifiers
FT   CDS             complement(407837..408151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0389"
FT                   /product="DNA-directed RNA polymerase, subunit M"
FT                   /EC_number="2.7.7.6"
FT                   /note="COGs: COG1594 DNA-directed RNA polymerase subunit
FT                   M/Transcription elongation factor TFIIS; InterPro
FT                   IPR001529:IPR001222:IPR019761:IPR006288; KEGG: hypothetical
FT                   protein; K03019 DNA-directed RNA polymerase III subunit
FT                   C11; PFAM: Transcription factor TFIIS; DNA-directed RNA
FT                   polymerase, M/15 kDa subunit; SMART: Transcription factor
FT                   TFIIS; DNA-directed RNA polymerase, M/15 kDa subunit; SPTR:
FT                   Q12U17 DNA-directed RNA polymerase, subunit M; TIGRFAM:
FT                   transcription factor S; PFAM: RNA polymerases M/15 Kd
FT                   subunit; Transcription factor S-II (TFIIS); TIGRFAM:
FT                   transcription factor S, archaeal"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35921"
FT                   /db_xref="GOA:D5E9S0"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR001529"
FT                   /db_xref="InterPro:IPR006288"
FT                   /db_xref="InterPro:IPR012164"
FT                   /db_xref="InterPro:IPR019761"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9S0"
FT                   /protein_id="ADE35921.1"
FT                   /translation="MEFCPKCKSMMFPSDGDLKCRKCGYEKSREEGAETMVSKTKRDER
FT                   EVTVLEENVDEGLPTTLAQCPECGNNKAYWWMRQLRSADESETRFFKCTKCSYTWREYD
FT                   "
     MEFCPKCKSM MFPSDGDLKC RKCGYEKSRE EGAETMVSKT KRDEREVTVL EENVDEGLPT        60
     TLAQCPECGN NKAYWWMRQL RSADESETRF FKCTKCSYTW REYD                        104
//

If you have problems or comments...

PBIL Back to PBIL home page