(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE386

CP001994.PE386       Location/Qualifiers
FT   CDS             409431..410132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0392"
FT                   /product="phosphatidylserine decarboxylase related protein"
FT                   /EC_number="4.1.1.65"
FT                   /note="COGs: COG0688 Phosphatidylserine decarboxylase;
FT                   InterPro IPR003817:IPR004428; KEGG: bbt:BBta_3505
FT                   phosphatidylserine decarboxylase; PFAM: phosphatidylserine
FT                   decarboxylase-related; PRIAM: Phosphatidylserine
FT                   decarboxylase; SPTR: Q12U14 Phosphatidylserine
FT                   decarboxylase proenzyme; TIGRFAM: phosphatidylserine
FT                   decarboxylase related protein; PFAM: Phosphatidylserine
FT                   decarboxylase; TIGRFAM: phosphatidylserine decarboxylase
FT                   precursor-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35924"
FT                   /db_xref="GOA:D5E9S3"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9S3"
FT                   /protein_id="ADE35924.1"
FT                   /translation="MLAKGSHSWVFTALLLTIAMGFMYVTSRLQIFIPQFMLDMPLLGG
FT                   NTFFLSLFSGWQIFLYSTFGFGLLTVFFVVFFRDPKRDSTLCKSCILAPADGKISDIRG
FT                   RKVCIFMNINNVHVNRAPFCGKVLSVKHFKGGYLPAFTKDSSRNERTNIMLQTSAGKIE
FT                   VTQIAGFLARRIVTYVEEGDDVLQGEKIGMIRLGSRVDVTIPEGFDICVSKGDKVYAGD
FT                   TKIAKTPHHER"
     MLAKGSHSWV FTALLLTIAM GFMYVTSRLQ IFIPQFMLDM PLLGGNTFFL SLFSGWQIFL        60
     YSTFGFGLLT VFFVVFFRDP KRDSTLCKSC ILAPADGKIS DIRGRKVCIF MNINNVHVNR       120
     APFCGKVLSV KHFKGGYLPA FTKDSSRNER TNIMLQTSAG KIEVTQIAGF LARRIVTYVE       180
     EGDDVLQGEK IGMIRLGSRV DVTIPEGFDI CVSKGDKVYA GDTKIAKTPH HER              233
//

If you have problems or comments...

PBIL Back to PBIL home page