(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE388

CP001994.PE388       Location/Qualifiers
FT   CDS             complement(410859..413468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0394"
FT                   /product="ATP-dependent chaperone ClpB"
FT                   /note="COGs: COG0542 ATPase with chaperone activity
FT                   ATP-binding subunit;
FT                   InterProIPR001270:IPR003959:IPR019489:IPR013093:IPR
FT                   011704:IPR004176:IPR003593:IPR018368:IPR017730; KEGG:
FT                   sfu:Sfum_0263 ATPase; PFAM: ATPase AAA-2 domain protein;
FT                   Clp ATPase-like; AAA ATPase central domain protein; ATPase
FT                   associated with various cellular activities AAA_5; Clp
FT                   domain protein; SMART: AAA ATPase; SPTR: A3QPW8 ClpB;
FT                   TIGRFAM: ATP-dependent chaperone ClpB; PFAM: AAA domain
FT                   (Cdc48 subfamily); C-terminal, D2-small domain, of ClpB
FT                   protein; Clp amino terminal domain; ATPase family
FT                   associated with various cellular activities (AAA); TIGRFAM:
FT                   ATP-dependent chaperone ClpB"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35926"
FT                   /db_xref="GOA:D5E9S5"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9S5"
FT                   /protein_id="ADE35926.1"
FT                   /translation="MDLNNFTQKAQEAIQNSRTIAARYYHQQIDSEHLFLSLLEQREGL
FT                   VPSLLERMNISSAMVKEQLEKHMSGLGQVSGPGSENVYFTQKAIRVLDNAATLASKMND
FT                   EYTSVEHILVSLVREKDSYSKKLLEEFGADEQRLKQAIKEIRGNRRVTSENPEDTYEPL
FT                   EKYGIDFTELANQGKLDPVIGRDHEIRHTIEILSRRRKNNPVLIGEAGVGKTAIVEGLA
FT                   QRIAKKDVPDAMKNKRIVALDMGSLVAGAKFRGEFEERLKAVLKEVAESEGLIILFIDE
FT                   LHTIVGAGATEGAMDAGNLLKPMLARGELHCIGATTLDEYRKYIEKDAALERRFMPVMV
FT                   NAPDVENTISILRGLKEKYEVHHGVRIKDSALVAAAVLSDRYISDRFLPDKAIDLLDEA
FT                   ASKVKTAIDSKPASLDEADRKLMQLEIEKEALKKEKDAASKERLQSLEKEISEIRAESD
FT                   AMRTRWENEKATIAKLNSLKEQIDDTKTQLDLAETEGDFEKASRLKYGTLVPLQHEYEE
FT                   EENRLKEKQTNMLLKEEVDEEDIAHVVSEWTRIPITKLMEGERDKLVHLEDRLHERVIG
FT                   QDEAVKAVSDAVIRAHAGIKDPRRPIGSFIFLGPTGVGKTELAKALATELFDSEDHMIR
FT                   IDMSEYMEKHTVARLIGAPPGYIGHDEGGQLTEAVRRNPYSVVLFDEIEKAHHDVFNIM
FT                   LQLLDDGRLTDSKGRTVDFKNTIVIMTSNICVDYAISKLEEGVAYSKMQETAMNELTKH
FT                   FRPEFLNRIDEIAIFRALTKDQLTYIVDIKIEDLVQRLKERRIDLEITDRAKKYLGDAG
FT                   YSETYGARPLKRVIQNELETEVGKRIVSKEVMESDTVVVDADERGLNFKVRKGEEHT"
     MDLNNFTQKA QEAIQNSRTI AARYYHQQID SEHLFLSLLE QREGLVPSLL ERMNISSAMV        60
     KEQLEKHMSG LGQVSGPGSE NVYFTQKAIR VLDNAATLAS KMNDEYTSVE HILVSLVREK       120
     DSYSKKLLEE FGADEQRLKQ AIKEIRGNRR VTSENPEDTY EPLEKYGIDF TELANQGKLD       180
     PVIGRDHEIR HTIEILSRRR KNNPVLIGEA GVGKTAIVEG LAQRIAKKDV PDAMKNKRIV       240
     ALDMGSLVAG AKFRGEFEER LKAVLKEVAE SEGLIILFID ELHTIVGAGA TEGAMDAGNL       300
     LKPMLARGEL HCIGATTLDE YRKYIEKDAA LERRFMPVMV NAPDVENTIS ILRGLKEKYE       360
     VHHGVRIKDS ALVAAAVLSD RYISDRFLPD KAIDLLDEAA SKVKTAIDSK PASLDEADRK       420
     LMQLEIEKEA LKKEKDAASK ERLQSLEKEI SEIRAESDAM RTRWENEKAT IAKLNSLKEQ       480
     IDDTKTQLDL AETEGDFEKA SRLKYGTLVP LQHEYEEEEN RLKEKQTNML LKEEVDEEDI       540
     AHVVSEWTRI PITKLMEGER DKLVHLEDRL HERVIGQDEA VKAVSDAVIR AHAGIKDPRR       600
     PIGSFIFLGP TGVGKTELAK ALATELFDSE DHMIRIDMSE YMEKHTVARL IGAPPGYIGH       660
     DEGGQLTEAV RRNPYSVVLF DEIEKAHHDV FNIMLQLLDD GRLTDSKGRT VDFKNTIVIM       720
     TSNICVDYAI SKLEEGVAYS KMQETAMNEL TKHFRPEFLN RIDEIAIFRA LTKDQLTYIV       780
     DIKIEDLVQR LKERRIDLEI TDRAKKYLGD AGYSETYGAR PLKRVIQNEL ETEVGKRIVS       840
     KEVMESDTVV VDADERGLNF KVRKGEEHT                                         869
//

If you have problems or comments...

PBIL Back to PBIL home page