(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE390

CP001994.PE390       Location/Qualifiers
FT   CDS             complement(415229..415504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0396"
FT                   /product="chaperonin Cpn10"
FT                   /note="COGs: COG0234 Co-chaperonin GroES (HSP10); InterPro
FT                   IPR001476; KEGG: scl:sce5910 GroES-like protein; PFAM:
FT                   chaperonin Cpn10; SPTR: A3QPW6 GroES; PFAM: Chaperonin 10
FT                   Kd subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35928"
FT                   /db_xref="GOA:D5E9S7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9S7"
FT                   /protein_id="ADE35928.1"
FT                   /translation="MNVKPVGERVLIKPIKEEEVTSGGIYIPESAQKEKKEGNVVAVGT
FT                   YEDGKELPVKKGDHIIYGGFQSDEMEMDGEKYLFIDFKDVLAIVEE"
     MNVKPVGERV LIKPIKEEEV TSGGIYIPES AQKEKKEGNV VAVGTYEDGK ELPVKKGDHI        60
     IYGGFQSDEM EMDGEKYLFI DFKDVLAIVE E                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page