(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE4

CP001994.PE4         Location/Qualifiers
FT   CDS             3651..4583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0004"
FT                   /product="Wyosine base formation domain protein"
FT                   /note="COGs: COG0731 Fe-S oxidoreductase; InterPro
FT                   IPR013917:IPR007197; KEGG: Os03g0775300; hypothetical
FT                   protein; PFAM: Wyosine base formation domain protein;
FT                   Radical SAM domain protein; SPTR: Q12V99 Fe-S protein,
FT                   radical SAM family; PFAM: Wyosine base formation; Radical
FT                   SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35542"
FT                   /db_xref="GOA:D5E8N3"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013917"
FT                   /db_xref="InterPro:IPR023993"
FT                   /db_xref="InterPro:IPR034556"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8N3"
FT                   /protein_id="ADE35542.1"
FT                   /translation="MASDLLPDIGTLIKKQGYRLAGSHSAVKTCLWMRRAVREEGECYK
FT                   ARFYGISSHRCLQMTPTLCCNQRCLHCWRPVELDVPTPQKWDSPVEIMGSSIECQRNLI
FT                   SGFGGSASRELWQQANEPAHVAISLSGEPTLYPYLDELIEEFRSRGVSTFVVTNGTVPE
FT                   TIKRIKPSQLYMSLDAPERQTYMEVCSPKDPCLWDNINESLSILKNKECRTAIRITLIK
FT                   GVNMFDVKGYADLIRKAQPDIIEVKAYMHLGFSRNRLERDAMPGHEEVLDFANQLGCEL
FT                   GYEVGDQVEISRVVMLFRDGKFVASKLPV"
     MASDLLPDIG TLIKKQGYRL AGSHSAVKTC LWMRRAVREE GECYKARFYG ISSHRCLQMT        60
     PTLCCNQRCL HCWRPVELDV PTPQKWDSPV EIMGSSIECQ RNLISGFGGS ASRELWQQAN       120
     EPAHVAISLS GEPTLYPYLD ELIEEFRSRG VSTFVVTNGT VPETIKRIKP SQLYMSLDAP       180
     ERQTYMEVCS PKDPCLWDNI NESLSILKNK ECRTAIRITL IKGVNMFDVK GYADLIRKAQ       240
     PDIIEVKAYM HLGFSRNRLE RDAMPGHEEV LDFANQLGCE LGYEVGDQVE ISRVVMLFRD       300
     GKFVASKLPV                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page