(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE400

CP001994.PE400       Location/Qualifiers
FT   CDS             424754..426289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0406"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG1031 Fe-S oxidoreductase; InterPro
FT                   IPR007197:IPR006638; KEGG: tmz:Tmz1t_0865 tRNA-i(6)A37
FT                   thiotransferase enzyme MiaB; PFAM: Radical SAM domain
FT                   protein; SMART: Elongator protein 3/MiaB/NifB; SPTR: Q12TW6
FT                   Fe-S protein, radical SAM family; PFAM: Radical SAM
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35938"
FT                   /db_xref="GOA:D5E9T7"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9T7"
FT                   /protein_id="ADE35938.1"
FT                   /translation="MKVAIIDGYVDEPACFGVPPYISPYIRYIAGALVECGIGRDDISY
FT                   FTIDGIRNSKREDLAPLSRSDLVVILSGMTVPGKYLRSSPITLKEIEYLCRATSGVKVI
FT                   GGPIRLGYSSEGGMAASTLEMADEDVFVARQDIEAFVHDIIGPGPCIEDPDNVEHRMRT
FT                   VGEIGRWADRGAFIIRRHPDFPNIMCEMETYRGCGRDTHCSFCTEFFYGPSTYRPVEDV
FT                   VTEAGSLYREGALYFRLGRQPDLFTYHALDCGDSLPGPNPQALESLYSGIRKVAPGLEV
FT                   LHMDNANPATIATYPDECSKIMKTILKYHTPGDVAAMGMESADPAVIRANNLKAMPDDV
FT                   FEAVKLMNEIGSIRGDNGLSHLLPGLNFVHGLAGETKKTFGLNYDFLKNILDNDLLLRR
FT                   INIRQVMPFSGTPAAEQALPLAKNRKIFLKYKEQVRKDIDLPMLRRVVPRGTILKDVLC
FT                   EVWGEGSVGTFGRQMGSYPILIGISEKLPLGEFVDVRVTGHGFRSISATVVRE"
     MKVAIIDGYV DEPACFGVPP YISPYIRYIA GALVECGIGR DDISYFTIDG IRNSKREDLA        60
     PLSRSDLVVI LSGMTVPGKY LRSSPITLKE IEYLCRATSG VKVIGGPIRL GYSSEGGMAA       120
     STLEMADEDV FVARQDIEAF VHDIIGPGPC IEDPDNVEHR MRTVGEIGRW ADRGAFIIRR       180
     HPDFPNIMCE METYRGCGRD THCSFCTEFF YGPSTYRPVE DVVTEAGSLY REGALYFRLG       240
     RQPDLFTYHA LDCGDSLPGP NPQALESLYS GIRKVAPGLE VLHMDNANPA TIATYPDECS       300
     KIMKTILKYH TPGDVAAMGM ESADPAVIRA NNLKAMPDDV FEAVKLMNEI GSIRGDNGLS       360
     HLLPGLNFVH GLAGETKKTF GLNYDFLKNI LDNDLLLRRI NIRQVMPFSG TPAAEQALPL       420
     AKNRKIFLKY KEQVRKDIDL PMLRRVVPRG TILKDVLCEV WGEGSVGTFG RQMGSYPILI       480
     GISEKLPLGE FVDVRVTGHG FRSISATVVR E                                      511
//

If you have problems or comments...

PBIL Back to PBIL home page