(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE401

CP001994.PE401       Location/Qualifiers
FT   CDS             426324..426854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0407"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="COGs: COG1047 FKBP-type peptidyl-prolyl cis-trans
FT                   isomerase 2; InterPro IPR001179; KEGG: predicted protein;
FT                   PFAM: peptidylprolyl isomerase FKBP-type; SPTR: Q12TV9
FT                   Peptidylprolyl isomerase, FKBP-type; PFAM: FKBP-type
FT                   peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35939"
FT                   /db_xref="GOA:D5E9T8"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9T8"
FT                   /protein_id="ADE35939.1"
FT                   /translation="MRKLLFIIAIAAILLISGCSTPAEVAEEGDNVTVDYVGELENGTV
FT                   FDTSVEEVALEAGIHNPARTYEPLGFTLGGEGMIKGFDSAVQGMTVGGEKTVQLSPEQA
FT                   YGSYKEELVRAVPFDDLPNKTTPYQIGDRLSTAYGQQVSIVDVNDTAAMIDFNHPLAGE
FT                   TLTFNITLVSIEE"
     MRKLLFIIAI AAILLISGCS TPAEVAEEGD NVTVDYVGEL ENGTVFDTSV EEVALEAGIH        60
     NPARTYEPLG FTLGGEGMIK GFDSAVQGMT VGGEKTVQLS PEQAYGSYKE ELVRAVPFDD       120
     LPNKTTPYQI GDRLSTAYGQ QVSIVDVNDT AAMIDFNHPL AGETLTFNIT LVSIEE           176
//

If you have problems or comments...

PBIL Back to PBIL home page