(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE407

CP001994.PE407       Location/Qualifiers
FT   CDS             432966..433343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0414"
FT                   /product="transcriptional regulator protein"
FT                   /note="COGs: COG4738 transcriptional regulator protein;
FT                   SPTR: Q12TV3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35945"
FT                   /db_xref="InterPro:IPR017185"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9U4"
FT                   /protein_id="ADE35945.1"
FT                   /translation="MEEDELFSMTENQREIAKLLRRLHLSKPIARTLACLSCGEEVSSR
FT                   KIESMSQLRQPEVSIAMNFLLKKKGWVEYEEIKRNEGKGRPIKVYKLVVPMDSIIESIE
FT                   HEILSENQILLENINRLKEFS"
     MEEDELFSMT ENQREIAKLL RRLHLSKPIA RTLACLSCGE EVSSRKIESM SQLRQPEVSI        60
     AMNFLLKKKG WVEYEEIKRN EGKGRPIKVY KLVVPMDSII ESIEHEILSE NQILLENINR       120
     LKEFS                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page