(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE408

CP001994.PE408       Location/Qualifiers
FT   CDS             433521..435818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0415"
FT                   /product="CoB--CoM heterodisulfide reductase subunit A"
FT                   /note="COGs: COG1148 Heterodisulfide reductase subunit A
FT                   and related polyferredoxins; InterPro
FT                   IPR001450:IPR003813:IPR017900; KEGG: dal:Dalk_1624
FT                   methyl-viologen-reducing hydrogenase delta subunit; PFAM:
FT                   methyl-viologen-reducing hydrogenase delta subunit; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein; SPTR: Q8PZV2
FT                   Heterodisulfide reductase subunit HdrA; PFAM: Pyridine
FT                   nucleotide-disulphide oxidoreductase;
FT                   Methyl-viologen-reducing hydrogenase, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35946"
FT                   /db_xref="GOA:D5E9U5"
FT                   /db_xref="InterPro:IPR003813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039650"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9U5"
FT                   /protein_id="ADE35946.1"
FT                   /translation="MNDSKKPSGIFICHCGGNISDNIDIKKLKDSFPDCKVFDYEYLCS
FT                   NRGQQYLKDEIENSGLERVVVGACTPAKHENLFKKCASQCGINQEFLRVVNLREQCSWV
FT                   HTDSDRATHKAFSMLNSSMLRLFRAQPVEQYSLPINPDALVIGGGIAGINAALNLANSG
FT                   VHTYLVEKETTIGGNAAKIGKIFSPEKLVEECAMCSLSPLMNEVASHPKIELLTDCEIR
FT                   NIDSITGNFQVSITQNPRYVTDKCVCCGKCAAVCPVVTENEFNCGSKDKKAVSIKFAQA
FT                   VPQIYSINPEHCIELKGGRCGKCREVCNVDAIDFSQQDKHIEIQVGAIIAATGFGEYDP
FT                   SSKPQYGYGRFPNVLTQMELARILGVNGPTQGKLLRPSDAKRPKNVVMIQCVGSRDEKS
FT                   SGNRYCSRYCCMAALKHASLIKKKYPDVNVTICYIDMRAFGLYEHYYRAVQEMAVQFVR
FT                   GRPAEIAERDNSELVVKVEDTLNQQLMELPADMVVLSAAMEPSEGTQQIARIMDTNLSE
FT                   DGFIKERHSKLRPVDTSKEGIFVCGSAQSPKDITDSIAQAGLAASRAHAFLAAGEIYLD
FT                   PHIAVADPDVCTLCGKCVTCPFGAISIEDKVKIDPLVCNGCGYCTSLCDEDAIHIRGYS
FT                   REELVAEIEGLAQAGDTIVFASCNIAYSTIDNIGSSAQDYPASTKIIRVPTTTIVTAEM
FT                   LDMAFNRGVFHVVFVEEPPDNQIGEIIYPLAEARFFELKAEYGDRLHLKKAYIPHAKGL
FT                   SDMFSSLEEVEE"
     MNDSKKPSGI FICHCGGNIS DNIDIKKLKD SFPDCKVFDY EYLCSNRGQQ YLKDEIENSG        60
     LERVVVGACT PAKHENLFKK CASQCGINQE FLRVVNLREQ CSWVHTDSDR ATHKAFSMLN       120
     SSMLRLFRAQ PVEQYSLPIN PDALVIGGGI AGINAALNLA NSGVHTYLVE KETTIGGNAA       180
     KIGKIFSPEK LVEECAMCSL SPLMNEVASH PKIELLTDCE IRNIDSITGN FQVSITQNPR       240
     YVTDKCVCCG KCAAVCPVVT ENEFNCGSKD KKAVSIKFAQ AVPQIYSINP EHCIELKGGR       300
     CGKCREVCNV DAIDFSQQDK HIEIQVGAII AATGFGEYDP SSKPQYGYGR FPNVLTQMEL       360
     ARILGVNGPT QGKLLRPSDA KRPKNVVMIQ CVGSRDEKSS GNRYCSRYCC MAALKHASLI       420
     KKKYPDVNVT ICYIDMRAFG LYEHYYRAVQ EMAVQFVRGR PAEIAERDNS ELVVKVEDTL       480
     NQQLMELPAD MVVLSAAMEP SEGTQQIARI MDTNLSEDGF IKERHSKLRP VDTSKEGIFV       540
     CGSAQSPKDI TDSIAQAGLA ASRAHAFLAA GEIYLDPHIA VADPDVCTLC GKCVTCPFGA       600
     ISIEDKVKID PLVCNGCGYC TSLCDEDAIH IRGYSREELV AEIEGLAQAG DTIVFASCNI       660
     AYSTIDNIGS SAQDYPASTK IIRVPTTTIV TAEMLDMAFN RGVFHVVFVE EPPDNQIGEI       720
     IYPLAEARFF ELKAEYGDRL HLKKAYIPHA KGLSDMFSSL EEVEE                       765
//

If you have problems or comments...

PBIL Back to PBIL home page