(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE409

CP001994.PE409       Location/Qualifiers
FT   CDS             435815..436420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0416"
FT                   /product="Heterodisulfide reductase subunit C"
FT                   /note="COGs: COG1150 Heterodisulfide reductase subunit C;
FT                   InterPro IPR017900; KEGG: afr:AFE_2555 iron-sulfur
FT                   cluster-binding protein; SPTR: Q46B51 Heterodisulfide
FT                   reductase subunit HdrC"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35947"
FT                   /db_xref="GOA:D5E9U6"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9U6"
FT                   /protein_id="ADE35947.1"
FT                   /translation="MNENHDTPECGSLVETVKKSLRTSDSIGIERCMQCGACTSSCPAA
FT                   RYSDYNPRNVMKRVKENDWSVIEDKTIWNCFYCYTCNLRCPRNNSPSQIVQVLRQMAIN
FT                   KGIGIERLSVLFEYPESFARLGISQIPAPYIGQMEEDLGKHWQHFRDNLEDIREELGLG
FT                   PLAIEDERGEIKALLKGIGFEDRFVRLKEMAAEEGEDE"
     MNENHDTPEC GSLVETVKKS LRTSDSIGIE RCMQCGACTS SCPAARYSDY NPRNVMKRVK        60
     ENDWSVIEDK TIWNCFYCYT CNLRCPRNNS PSQIVQVLRQ MAINKGIGIE RLSVLFEYPE       120
     SFARLGISQI PAPYIGQMEE DLGKHWQHFR DNLEDIREEL GLGPLAIEDE RGEIKALLKG       180
     IGFEDRFVRL KEMAAEEGED E                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page