(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE410

CP001994.PE410       Location/Qualifiers
FT   CDS             436417..437352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0417"
FT                   /product="CoB--CoM heterodisulfide reductase"
FT                   /EC_number="1.8.98.1"
FT                   /note="COGs: COG2048 Heterodisulfide reductase subunit B;
FT                   InterPro IPR004017; KEGG: dal:Dalk_5067 CoB--CoM
FT                   heterodisulfide reductase; PFAM: protein of unknown
FT                   function DUF224 cysteine-rich region domain protein; PRIAM:
FT                   CoB--CoM heterodisulfide reductase; SPTR: Q8PZV0
FT                   Heterodisulfide reductase subunit HdrB; PFAM: Cysteine-rich
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35948"
FT                   /db_xref="GOA:D5E9U7"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9U7"
FT                   /protein_id="ADE35948.1"
FT                   /translation="MKELADVPVKGLLLFKSCLVSSEYPGIESSTKYAFDRLGVDYLVS
FT                   GEQSCCTGLGHYFDLFDQMTTTAIAARNFAVAKKEGYTNITTMCATCYAINKKSCSLLN
FT                   NNRQVISLVNDNVEAAGLDDLKYEADSFDEVGNFYHVVEVLAKNANRIGELSIIDFAGV
FT                   KMAAHHACHYYKIDYEDVAGNPEHPELIDHIAKACGGDVVEWYEDRTLTCGAGFSQRYV
FT                   NREMSLKATHAKLESLKRADVQLVLHMCPNCQVQYDRYQPVIEKEFGEEYDMVHMNIAQ
FT                   FTALALGGDPWKICGFQTHSVDLTDFLKTL"
     MKELADVPVK GLLLFKSCLV SSEYPGIESS TKYAFDRLGV DYLVSGEQSC CTGLGHYFDL        60
     FDQMTTTAIA ARNFAVAKKE GYTNITTMCA TCYAINKKSC SLLNNNRQVI SLVNDNVEAA       120
     GLDDLKYEAD SFDEVGNFYH VVEVLAKNAN RIGELSIIDF AGVKMAAHHA CHYYKIDYED       180
     VAGNPEHPEL IDHIAKACGG DVVEWYEDRT LTCGAGFSQR YVNREMSLKA THAKLESLKR       240
     ADVQLVLHMC PNCQVQYDRY QPVIEKEFGE EYDMVHMNIA QFTALALGGD PWKICGFQTH       300
     SVDLTDFLKT L                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page