(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE411

CP001994.PE411       Location/Qualifiers
FT   CDS             437432..438673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0418"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="COGs: COG0065 3-isopropylmalate dehydratase large
FT                   subunit; InterPro IPR001030:IPR018136:IPR011826:IPR006251;
FT                   KEGG: sfu:Sfum_3029 3-isopropylmalate dehydratase, large
FT                   subunit; PFAM: aconitate hydratase domain protein; SPTR:
FT                   Q12TV2 3-isopropylmalate dehydratase, large subunit;
FT                   TIGRFAM: 3-isopropylmalate dehydratase; homoaconitate
FT                   hydratase family protein; PFAM: Aconitase family (aconitate
FT                   hydratase); TIGRFAM: 3-isopropylmalate dehydratase, large
FT                   subunit; homoaconitate hydratase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35949"
FT                   /db_xref="GOA:D5E9U8"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9U8"
FT                   /protein_id="ADE35949.1"
FT                   /translation="MSTISEKIFSRAAGKEAKANDFVIADIDYAMAHDGTSILAVRSFR
FT                   QMEVEKVWDPSRIVIPFDHLAPANSDTTAGLQKDIRGWVRQQGIRNFYDIGNGICHQVL
FT                   PEKGFAMPGKLIVGADSHSCTYGAFGAFGTGVGATDMAEIFASGKLWFRVPESIRITAE
FT                   GKLDDRVCAKDLTLKIIGEVTASGATYKAVEFYGDAIENLSMAGRMTLSNMAIEMGAKA
FT                   GIVPPDATTFEYLKNRAVSDYEPVYSDGDADYVAEYHIDVNSLEPQVACPHEVDNVCGV
FT                   SGIAGKKLDQAFIGTCTNGRLEDLEAAAEVLKGNEVAVRTIIIPASRQIMKEAASKGLI
FT                   EIFLDAGATMGTPGCGPCLGGHMGVIGEGEVCISTANRNFRGRMGTGGYIYLASPATVA
FT                   ASAIKGEITDPRNV"
     MSTISEKIFS RAAGKEAKAN DFVIADIDYA MAHDGTSILA VRSFRQMEVE KVWDPSRIVI        60
     PFDHLAPANS DTTAGLQKDI RGWVRQQGIR NFYDIGNGIC HQVLPEKGFA MPGKLIVGAD       120
     SHSCTYGAFG AFGTGVGATD MAEIFASGKL WFRVPESIRI TAEGKLDDRV CAKDLTLKII       180
     GEVTASGATY KAVEFYGDAI ENLSMAGRMT LSNMAIEMGA KAGIVPPDAT TFEYLKNRAV       240
     SDYEPVYSDG DADYVAEYHI DVNSLEPQVA CPHEVDNVCG VSGIAGKKLD QAFIGTCTNG       300
     RLEDLEAAAE VLKGNEVAVR TIIIPASRQI MKEAASKGLI EIFLDAGATM GTPGCGPCLG       360
     GHMGVIGEGE VCISTANRNF RGRMGTGGYI YLASPATVAA SAIKGEITDP RNV              413
//

If you have problems or comments...

PBIL Back to PBIL home page