(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE417

CP001994.PE417       Location/Qualifiers
FT   CDS             441472..442065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0424"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR000182"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35955"
FT                   /db_xref="GOA:D5E9V4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9V4"
FT                   /protein_id="ADE35955.1"
FT                   /translation="MRLTEDRDIGRVACCKEAIDASRAIYDSFSLLDYFHDCEFAMHSR
FT                   RFAWGEAVAYVYEARDAIYILLLFSRQQKRGHGHRLVNCIIGHARYKGYSRVYVTTSYR
FT                   SPHHYAAGRFYVSCGFRMIGSDEEHMYYGLDVNTAHVSDCTNDYANPPELLYRLSDYFL
FT                   ILIALLVVFLKPQRDEPQVVKMLRKIISEKEKSQ"
     MRLTEDRDIG RVACCKEAID ASRAIYDSFS LLDYFHDCEF AMHSRRFAWG EAVAYVYEAR        60
     DAIYILLLFS RQQKRGHGHR LVNCIIGHAR YKGYSRVYVT TSYRSPHHYA AGRFYVSCGF       120
     RMIGSDEEHM YYGLDVNTAH VSDCTNDYAN PPELLYRLSD YFLILIALLV VFLKPQRDEP       180
     QVVKMLRKII SEKEKSQ                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page