(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE42

CP001994.PE42        Location/Qualifiers
FT   CDS             46126..47712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0043"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="COGs: COG0747 ABC-type dipeptide transport system
FT                   periplasmic component; InterPro IPR000914; KEGG:
FT                   pca:Pcar_1870 dipeptide transport protein; PFAM:
FT                   extracellular solute-binding protein family 5; SPTR: Q8TIA8
FT                   Dipeptide ABC transporter, solute-binding protein; PFAM:
FT                   Bacterial extracellular solute-binding proteins, family 5
FT                   Middle"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35580"
FT                   /db_xref="GOA:D5E8S1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8S1"
FT                   /protein_id="ADE35580.1"
FT                   /translation="MMNLRKSSTYLIILLCTISILIAGCADQQQNEDNNINENDTQAKI
FT                   VEIAQTFGPSDSLDPSSRWVGWYVREAGLYETLFSYDENMEMIPELATGYEAINDTAWQ
FT                   IILRENVTFHDGTPMTSEAVVYSINRVRDPDNTRSSQYDFIENIEALDDYTVLITTEKP
FT                   YAPAIASLTDPIVSIVNPEATDLAVSPSGTGPYAFESFEPGIELVVKKNNNYWSGKPQL
FT                   DAAVFNYVSDPVTRSLKLEGGDVQIADGIPPAEVARLDAKDDIKIHNEETMRTGFMYVN
FT                   TRKAPLDDIHVRQAINHAINREQVIDAALEGVGGSPAVGVFPSLFSWSANEQLDPYEHN
FT                   PEKALEMFRQAGIEDVDGDGTLDYGGEAFSLNIKTYASRPEMKPAAEAMAAQFQEIGIE
FT                   SEAIILESGALSADMSDGNYDLGLYAWGVAPTGDPDYFLSQHFASDSKYAGWTGYSNED
FT                   VDEWLKMGRTTMDNDKRLEYYNNVQREVFEECPEIFVFYYRKTVGTSDEVQGFTIYPNE
FT                   ITFLTEDVRLE"
     MMNLRKSSTY LIILLCTISI LIAGCADQQQ NEDNNINEND TQAKIVEIAQ TFGPSDSLDP        60
     SSRWVGWYVR EAGLYETLFS YDENMEMIPE LATGYEAIND TAWQIILREN VTFHDGTPMT       120
     SEAVVYSINR VRDPDNTRSS QYDFIENIEA LDDYTVLITT EKPYAPAIAS LTDPIVSIVN       180
     PEATDLAVSP SGTGPYAFES FEPGIELVVK KNNNYWSGKP QLDAAVFNYV SDPVTRSLKL       240
     EGGDVQIADG IPPAEVARLD AKDDIKIHNE ETMRTGFMYV NTRKAPLDDI HVRQAINHAI       300
     NREQVIDAAL EGVGGSPAVG VFPSLFSWSA NEQLDPYEHN PEKALEMFRQ AGIEDVDGDG       360
     TLDYGGEAFS LNIKTYASRP EMKPAAEAMA AQFQEIGIES EAIILESGAL SADMSDGNYD       420
     LGLYAWGVAP TGDPDYFLSQ HFASDSKYAG WTGYSNEDVD EWLKMGRTTM DNDKRLEYYN       480
     NVQREVFEEC PEIFVFYYRK TVGTSDEVQG FTIYPNEITF LTEDVRLE                    528
//

If you have problems or comments...

PBIL Back to PBIL home page