(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE426

CP001994.PE426       Location/Qualifiers
FT   CDS             complement(455923..456033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35964"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9W3"
FT                   /protein_id="ADE35964.1"
FT                   /translation="MQLTDSDDELFDILMDAIKHNPDIFIKTVQKNKTNQ"
     MQLTDSDDEL FDILMDAIKH NPDIFIKTVQ KNKTNQ                                  36
//

If you have problems or comments...

PBIL Back to PBIL home page