(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE430

CP001994.PE430       Location/Qualifiers
FT   CDS             458163..459644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0438"
FT                   /product="protein of unknown function UPF0027"
FT                   /note="COGs: COG1690 conserved hypothetical protein;
FT                   InterPro IPR001233; KEGG: dol:Dole_2571 hypothetical
FT                   protein; PFAM: protein of unknown function UPF0027; SPTR:
FT                   Q12U04 Putative uncharacterized protein; PFAM:
FT                   Uncharacterized protein family UPF0027"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35968"
FT                   /db_xref="GOA:D5E9W7"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9W7"
FT                   /protein_id="ADE35968.1"
FT                   /translation="MKRGFDRMDTEGPEIEGLERIDNDIWQVPMGYKSGMRVPGRIYLS
FT                   DKLFANLEKEAVDQVANVATLPGIQKFSMAMPDAHVGYGFPIGGVAAFDAEEGVISPGG
FT                   VGFDINCGVRLIRSNLDKSDVDGKVNDLLDSLFKAVPSGVGSKSRIRASESELEAIFTN
FT                   GSRWAVEQGYGVEADLTHCEGEGCIEGGDPAQVSAKARKRGRPQLGTLGSGNHFLELQY
FT                   VDEIYDPVAAEAFNLKQGQLTFMVHCGSRGAGHQVCTDHLRNLTRAVEKYKIDLPDKQL
FT                   ACAPAQSEEAQAYFGAMASAANYAWTNRQIIMHHCREVFEQQMNMDADELGLDLVYDVA
FT                   HNVAKLEEHNVNGGKKQVYVHRKGATRAFPAGHHEVPKAYRDVGQPVLIPGSMGTPSYV
FT                   LCGKQSAMDVSFGSACHGAGRVMSRSGAKHTFRGEQIQKDLSGQGISVRAAHPSVIAEE
FT                   APGVYKSSSEVVDVVDRLGIAGKVAKLMPVGVVKG"
     MKRGFDRMDT EGPEIEGLER IDNDIWQVPM GYKSGMRVPG RIYLSDKLFA NLEKEAVDQV        60
     ANVATLPGIQ KFSMAMPDAH VGYGFPIGGV AAFDAEEGVI SPGGVGFDIN CGVRLIRSNL       120
     DKSDVDGKVN DLLDSLFKAV PSGVGSKSRI RASESELEAI FTNGSRWAVE QGYGVEADLT       180
     HCEGEGCIEG GDPAQVSAKA RKRGRPQLGT LGSGNHFLEL QYVDEIYDPV AAEAFNLKQG       240
     QLTFMVHCGS RGAGHQVCTD HLRNLTRAVE KYKIDLPDKQ LACAPAQSEE AQAYFGAMAS       300
     AANYAWTNRQ IIMHHCREVF EQQMNMDADE LGLDLVYDVA HNVAKLEEHN VNGGKKQVYV       360
     HRKGATRAFP AGHHEVPKAY RDVGQPVLIP GSMGTPSYVL CGKQSAMDVS FGSACHGAGR       420
     VMSRSGAKHT FRGEQIQKDL SGQGISVRAA HPSVIAEEAP GVYKSSSEVV DVVDRLGIAG       480
     KVAKLMPVGV VKG                                                          493
//

If you have problems or comments...

PBIL Back to PBIL home page