(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE431

CP001994.PE431       Location/Qualifiers
FT   CDS             459837..460316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0439"
FT                   /product="PUA domain containing protein"
FT                   /note="COGs: COG1370 Prefoldin molecular chaperone
FT                   implicated in de novo protein folding alpha subunit;
FT                   InterPro IPR002478; PFAM: PUA domain containing protein;
FT                   SMART: PUA domain containing protein; SPTR: Q12U05 PUA
FT                   domain protein; PFAM: PUA domain; TIGRFAM: uncharacterized
FT                   domain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35969"
FT                   /db_xref="GOA:D5E9W8"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029402"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR038250"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9W8"
FT                   /protein_id="ADE35969.1"
FT                   /translation="MAMTKEESRIKQVRTMADYQFGKGCGNILFSGDITFKLSRTKRIR
FT                   QIFSEEKRMATVRARDGMFTLSIEGASRIHSHLPAPGYRVMMCDDAIPFVSKGKTAFAK
FT                   HVENIDSDLRAGDEVLLVDKHDNLIATGQLLLAPEEVLAMQNGPAVDVRVGVNSS"
     MAMTKEESRI KQVRTMADYQ FGKGCGNILF SGDITFKLSR TKRIRQIFSE EKRMATVRAR        60
     DGMFTLSIEG ASRIHSHLPA PGYRVMMCDD AIPFVSKGKT AFAKHVENID SDLRAGDEVL       120
     LVDKHDNLIA TGQLLLAPEE VLAMQNGPAV DVRVGVNSS                              159
//

If you have problems or comments...

PBIL Back to PBIL home page