(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE434

CP001994.PE434       Location/Qualifiers
FT   CDS             462459..463544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0442"
FT                   /product="histidinol phosphate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.9"
FT                   /note="COGs: COG0079 Histidinol-phosphate/aromatic
FT                   aminotransferase and cobyric acid decarboxylase; InterPro
FT                   IPR004839:IPR000277:IPR001917:IPR005861; KEGG:
FT                   dol:Dole_1983 histidinol-phosphate aminotransferase; PFAM:
FT                   aminotransferase class I and II; Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; SPTR: Q12U08
FT                   Histidinol-phosphate aminotransferase; TIGRFAM:
FT                   histidinol-phosphate aminotransferase; PFAM:
FT                   Aminotransferase class I and II; TIGRFAM:
FT                   histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35972"
FT                   /db_xref="GOA:D5E9X1"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9X1"
FT                   /protein_id="ADE35972.1"
FT                   /translation="MAIYELVKPEIRSIAPYVPGKSIAEIAEKYNLESDSIIKLGSNEN
FT                   PLGPSPAAVSALQEAAATVNIYPSADARELVDAISAYVGMPQANIVASGPGMDGLLDGL
FT                   MRMLMSADSEVVVTTPTFSYYEISATACGAKPVFVKRNENFDVDIDRVIAAVNENTKVV
FT                   FICSPNNPTGNITAEKELRRLLDSVECLVFVDEAYVEFAGSDIASLVGEYDNLVVGRTF
FT                   SKAFGLAGLRLGYGIMPAWLKVEYMKAATPFNVSAPAVAAGIAALSDREHLEASQQMVI
FT                   DGREYLQANLPFKVYGSQANFMLVDVAPNSAKDVCDHLLRRGIIVRDCTSFRDAGDSFI
FT                   RVTVGTEEQNARIVEGFSTYL"
     MAIYELVKPE IRSIAPYVPG KSIAEIAEKY NLESDSIIKL GSNENPLGPS PAAVSALQEA        60
     AATVNIYPSA DARELVDAIS AYVGMPQANI VASGPGMDGL LDGLMRMLMS ADSEVVVTTP       120
     TFSYYEISAT ACGAKPVFVK RNENFDVDID RVIAAVNENT KVVFICSPNN PTGNITAEKE       180
     LRRLLDSVEC LVFVDEAYVE FAGSDIASLV GEYDNLVVGR TFSKAFGLAG LRLGYGIMPA       240
     WLKVEYMKAA TPFNVSAPAV AAGIAALSDR EHLEASQQMV IDGREYLQAN LPFKVYGSQA       300
     NFMLVDVAPN SAKDVCDHLL RRGIIVRDCT SFRDAGDSFI RVTVGTEEQN ARIVEGFSTY       360
     L                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page