(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE435

CP001994.PE435       Location/Qualifiers
FT   CDS             complement(463539..463901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0443"
FT                   /product="Protein of unknown function DUF381"
FT                   /note="COGs: COG2098 conserved hypothetical protein;
FT                   InterPro IPR007179:IPR007181; PFAM: Protein of unknown
FT                   function DUF381; Protein of unknown function DUF372; SPTR:
FT                   Q46E45 Putative uncharacterized protein; PFAM: Domain of
FT                   unknown function (DUF381); Domain of unknown function
FT                   (DUF372)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35973"
FT                   /db_xref="GOA:D5E9X2"
FT                   /db_xref="InterPro:IPR007181"
FT                   /db_xref="InterPro:IPR027508"
FT                   /db_xref="InterPro:IPR036839"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9X2"
FT                   /protein_id="ADE35973.1"
FT                   /translation="MENRPDDAQIAAFEAGIKLGALYHQFTGSPLNLQNADSMERAIAE
FT                   SISVQPFVEEINVNINRDMIATKLNDEFGYCELEGRMLTVGLQVIHGNTRIRASMTYNQ
FT                   ERDYPLMEINEVESLS"
     MENRPDDAQI AAFEAGIKLG ALYHQFTGSP LNLQNADSME RAIAESISVQ PFVEEINVNI        60
     NRDMIATKLN DEFGYCELEG RMLTVGLQVI HGNTRIRASM TYNQERDYPL MEINEVESLS       120
//

If you have problems or comments...

PBIL Back to PBIL home page