(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE436

CP001994.PE436       Location/Qualifiers
FT   CDS             464007..464498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0444"
FT                   /product="Rubrerythrin"
FT                   /note="COGs: COG1592 Rubrerythrin; InterPro
FT                   IPR004039:IPR003251:IPR009040; KEGG: glo:Glov_1794
FT                   rubrerythrin; PFAM: Rubrerythrin; Rubredoxin-type Fe(Cys)4
FT                   protein; SPTR: O26912 Rubrerythrin; PFAM: Rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35974"
FT                   /db_xref="GOA:D5E9X3"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9X3"
FT                   /protein_id="ADE35974.1"
FT                   /translation="MSTLENLEGAFAGESMANRKYLAFAKKADDEGFPQIAKLFRAAAA
FT                   AETVHAHNHLEIMNGIKSTEENLREAIEGETYEFEEMYPAFITQAKKEDNGKAAWSFDV
FT                   ANQVEAIHAELYKKALDNAGNNDEVDYYVCEVCGNTVENGAPDVCPICGAPASKFKKID
FT                   "
     MSTLENLEGA FAGESMANRK YLAFAKKADD EGFPQIAKLF RAAAAAETVH AHNHLEIMNG        60
     IKSTEENLRE AIEGETYEFE EMYPAFITQA KKEDNGKAAW SFDVANQVEA IHAELYKKAL       120
     DNAGNNDEVD YYVCEVCGNT VENGAPDVCP ICGAPASKFK KID                         163
//

If you have problems or comments...

PBIL Back to PBIL home page