(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE441

CP001994.PE441       Location/Qualifiers
FT   CDS             complement(469415..470641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0449"
FT                   /product="Proteasome-activating nucleotidase"
FT                   /EC_number="3.6.1.3"
FT                   /note="COGs: COG1222 ATP-dependent 26S proteasome
FT                   regulatory subunit;
FT                   InterProIPR003959:IPR011704:IPR003593:IPR003960:IPR 005937;
FT                   KEGG: hypothetical protein; K03066 26S proteasome
FT                   regulatory subunit T6; PFAM: AAA ATPase central domain
FT                   protein; ATPase associated with various cellular activities
FT                   AAA_5; PRIAM: Adenosinetriphosphatase; SMART: AAA ATPase;
FT                   SPTR: Q12TR9 26S proteasome subunit P45 family; TIGRFAM:
FT                   26S proteasome subunit P45 family; PFAM: ATPase family
FT                   associated with various cellular activities (AAA); TIGRFAM:
FT                   26S proteasome subunit P45 family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35979"
FT                   /db_xref="GOA:D5E9X8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9X8"
FT                   /protein_id="ADE35979.1"
FT                   /translation="MSDATANTPIENTNNTVDNAEEMDSEIESLKKENEELRVQSESMR
FT                   AKLLEANMLANNYLEEMEKLKEQLERITSPPLFIATVMETEDDMALIRQHGNNQEVVTQ
FT                   IPAEFRDEIEPGVRVSINAAFSIVSIMRKATDMRAQIMEVINSPDVDYDMIGGLDDVLN
FT                   EVIESVEMPLTEPELFDKIGIEPPSGVLMYGDPGTGKTLIAKAVASRAHASFIRMSGSD
FT                   LVQKFIGEGARLVKDVFQMARDKSPCILFIDEIDAVGGMRTHDGTTGSAEVNRTMLQLL
FT                   SEMDGFEPRGQVKIIAATNRIDLLDPALLRPGRFDRVIEIPIPDEKAREDILRIHTRHM
FT                   NLADDVDMAKLAKMANGLSGADLKIIVKEAGMFVLRRRGEQITMKDMTEAFNKITTEEE
FT                   QGTVSGMFA"
     MSDATANTPI ENTNNTVDNA EEMDSEIESL KKENEELRVQ SESMRAKLLE ANMLANNYLE        60
     EMEKLKEQLE RITSPPLFIA TVMETEDDMA LIRQHGNNQE VVTQIPAEFR DEIEPGVRVS       120
     INAAFSIVSI MRKATDMRAQ IMEVINSPDV DYDMIGGLDD VLNEVIESVE MPLTEPELFD       180
     KIGIEPPSGV LMYGDPGTGK TLIAKAVASR AHASFIRMSG SDLVQKFIGE GARLVKDVFQ       240
     MARDKSPCIL FIDEIDAVGG MRTHDGTTGS AEVNRTMLQL LSEMDGFEPR GQVKIIAATN       300
     RIDLLDPALL RPGRFDRVIE IPIPDEKARE DILRIHTRHM NLADDVDMAK LAKMANGLSG       360
     ADLKIIVKEA GMFVLRRRGE QITMKDMTEA FNKITTEEEQ GTVSGMFA                    408
//

If you have problems or comments...

PBIL Back to PBIL home page