(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE443

CP001994.PE443       Location/Qualifiers
FT   CDS             471916..472164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0451"
FT                   /product="Protein of unknown function DUF131"
FT                   /note="InterPro IPR002849; PFAM: Protein of unknown
FT                   function DUF131; SPTR: Q8TIM6 Putative uncharacterized
FT                   protein; PFAM: Protein of unknown function DUF131; TIGRFAM:
FT                   conserved hypothetical protein TIGR00304"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35981"
FT                   /db_xref="GOA:D5E9Y0"
FT                   /db_xref="InterPro:IPR002849"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Y0"
FT                   /protein_id="ADE35981.1"
FT                   /translation="MNSAENSITKGFVLITIGFFLLFLGFITKAIYGNGAQSEFGGLVL
FT                   IGPIPIVIGSSVGVSYSMLLLGLLIFAIYILLWRTNR"
     MNSAENSITK GFVLITIGFF LLFLGFITKA IYGNGAQSEF GGLVLIGPIP IVIGSSVGVS        60
     YSMLLLGLLI FAIYILLWRT NR                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page