(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE444

CP001994.PE444       Location/Qualifiers
FT   CDS             472161..472472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0452"
FT                   /product="Protein of unknown function DUF131"
FT                   /note="InterPro IPR002849; PFAM: Protein of unknown
FT                   function DUF131; SPTR: Q8TIM7 Putative uncharacterized
FT                   protein; PFAM: Protein of unknown function DUF131; TIGRFAM:
FT                   conserved hypothetical protein TIGR00304"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35982"
FT                   /db_xref="GOA:D5E9Y1"
FT                   /db_xref="InterPro:IPR002849"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Y1"
FT                   /protein_id="ADE35982.1"
FT                   /translation="MIGNILVYGGMAFIGIGIFLIMRGVYEQNVFHKKQSSSQTHGHVN
FT                   EIHTGDEGDYSRTDVKSGGVIMIGPLPIIFGSDSNTSKKAMVLAIILMLIYLLVVVLV"
     MIGNILVYGG MAFIGIGIFL IMRGVYEQNV FHKKQSSSQT HGHVNEIHTG DEGDYSRTDV        60
     KSGGVIMIGP LPIIFGSDSN TSKKAMVLAI ILMLIYLLVV VLV                         103
//

If you have problems or comments...

PBIL Back to PBIL home page