(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE45

CP001994.PE45        Location/Qualifiers
FT   CDS             49433..50266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0046"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1173 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems permease components; InterPro IPR000515;
FT                   KEGG: dde:Dde_2594 oligopeptide ABC transporter, permease
FT                   protein; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: Q8TIA4 Oligopeptide ABC
FT                   transporter, permease protein; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35583"
FT                   /db_xref="GOA:D5E8S4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8S4"
FT                   /protein_id="ADE35583.1"
FT                   /translation="MIKGIFNRSMLIGLILIGAVVFLALAAPWLAPQDPQKTNFDQRLL
FT                   SPSSEYPFGTDHLGRCILSRVLFAARISLFIGASVIAISFIAGTLIGSVSAYAGGIVDE
FT                   TVMRFVDGFLAFPSMFIALAIAGIFGGNMTGLIIALSIVEWTAYARVSRGSVLTVKNVD
FT                   YIAVSRMMGGRAPYILRHHILPNITSPLLVISTLGMGNVILAAAGLSFLGLGVSSAPEW
FT                   GMMVNEGRLFLQSAPHVMFFPGIFIVITVLGFNFLGDGLRDIFDPRDTKQRWRLF"
     MIKGIFNRSM LIGLILIGAV VFLALAAPWL APQDPQKTNF DQRLLSPSSE YPFGTDHLGR        60
     CILSRVLFAA RISLFIGASV IAISFIAGTL IGSVSAYAGG IVDETVMRFV DGFLAFPSMF       120
     IALAIAGIFG GNMTGLIIAL SIVEWTAYAR VSRGSVLTVK NVDYIAVSRM MGGRAPYILR       180
     HHILPNITSP LLVISTLGMG NVILAAAGLS FLGLGVSSAP EWGMMVNEGR LFLQSAPHVM       240
     FFPGIFIVIT VLGFNFLGDG LRDIFDPRDT KQRWRLF                                277
//

If you have problems or comments...

PBIL Back to PBIL home page