(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE450

CP001994.PE450       Location/Qualifiers
FT   CDS             complement(478176..479354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0458"
FT                   /product="SCP-like extracellular"
FT                   /note="COGs: COG2340 Uncharacterized protein with SCP/PR1
FT                   domains; InterPro IPR014044; KEGG: mes:Meso_3523 allergen
FT                   V5/TPX-1 related; PFAM: SCP-like extracellular; SPTR:
FT                   B9ZCZ8 SCP-like extracellular; PFAM: Cysteine-rich
FT                   secretory protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35988"
FT                   /db_xref="GOA:D5E9Y7"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Y7"
FT                   /protein_id="ADE35988.1"
FT                   /translation="MKYYQELISLNKEDLLKNKFENRAFNVFILIGFIIAITSAGCLQS
FT                   NSMEFNFYVEETGENLNGNVYIDDKFLGTTENGILNAPKDELYPGEISLKGNYEGDSFV
FT                   FYYDFFESDFEYNAIDFTVPESRLADISYSAEDVITDSAEDSIFQLINEERKYLDITPL
FT                   ERSEILDDIAESRSKDMVQRGYFSHTTPDGYGVGDILKENEIFYFSATENLMYLPVNRT
FT                   TDIADETVQGWIESPGHRIPVLDTDKPILWDHVGIGVVATDESVDDGKETACYITAVFA
FT                   SFDSTYEDTLPNGYTQYYNIYDKSLGLEFDTNVNIKLQSSDDVDFYIVSDEEKYDDFLN
FT                   RQNIQSSSVISKNDIQYFDREIEIEPGYGAIIDASESYKDVEYELSMVYNPE"
     MKYYQELISL NKEDLLKNKF ENRAFNVFIL IGFIIAITSA GCLQSNSMEF NFYVEETGEN        60
     LNGNVYIDDK FLGTTENGIL NAPKDELYPG EISLKGNYEG DSFVFYYDFF ESDFEYNAID       120
     FTVPESRLAD ISYSAEDVIT DSAEDSIFQL INEERKYLDI TPLERSEILD DIAESRSKDM       180
     VQRGYFSHTT PDGYGVGDIL KENEIFYFSA TENLMYLPVN RTTDIADETV QGWIESPGHR       240
     IPVLDTDKPI LWDHVGIGVV ATDESVDDGK ETACYITAVF ASFDSTYEDT LPNGYTQYYN       300
     IYDKSLGLEF DTNVNIKLQS SDDVDFYIVS DEEKYDDFLN RQNIQSSSVI SKNDIQYFDR       360
     EIEIEPGYGA IIDASESYKD VEYELSMVYN PE                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page