(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE452

CP001994.PE452       Location/Qualifiers
FT   CDS             480146..480676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0460"
FT                   /product="integrase family protein"
FT                   /note="COGs: COG4974 Site-specific recombinase XerD;
FT                   InterPro IPR002104; KEGG: sdn:Sden_1137 phage integrase;
FT                   PFAM: integrase family protein; SPTR: A8TGC2 Integrase
FT                   family protein; PFAM: Phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35990"
FT                   /db_xref="GOA:D5E9Y9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Y9"
FT                   /protein_id="ADE35990.1"
FT                   /translation="MLNNPNISEKYEIWILLMYTPALRVTEAINIRVKDIDLEDECIDI
FT                   WGGKGRDVTELQKAPCNIRVLKRIKRFCEHSDLRPTGYIMYSQKSKQVNRSHVYKVFND
FT                   ICSESGINKTIGTHTMRRSRAEHLLDKGLPLTFVSKYLRYKNLSTTMKYLDVSVADIQR
FT                   EMEMIDDCVNALV"
     MLNNPNISEK YEIWILLMYT PALRVTEAIN IRVKDIDLED ECIDIWGGKG RDVTELQKAP        60
     CNIRVLKRIK RFCEHSDLRP TGYIMYSQKS KQVNRSHVYK VFNDICSESG INKTIGTHTM       120
     RRSRAEHLLD KGLPLTFVSK YLRYKNLSTT MKYLDVSVAD IQREMEMIDD CVNALV           176
//

If you have problems or comments...

PBIL Back to PBIL home page