(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE456

CP001994.PE456       Location/Qualifiers
FT   CDS             complement(485415..485912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35994"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Z3"
FT                   /protein_id="ADE35994.1"
FT                   /translation="MDCFDEAAAWYLNKIKRIPQDPGKLGCENCLTIEQLLDLFTGKYY
FT                   IQEKFKGGLVARGTRGRSYAIYYDSDMNHNVDKIIVRRNNVKCFKDFTGRKVGTPNSVT
FT                   YFASEFSTDTPSIKEIYEVLNNYLHEPALYDKNNKAGIVVKNYGTFGPGRYLFGEYLMD
FT                   ES"
     MDCFDEAAAW YLNKIKRIPQ DPGKLGCENC LTIEQLLDLF TGKYYIQEKF KGGLVARGTR        60
     GRSYAIYYDS DMNHNVDKII VRRNNVKCFK DFTGRKVGTP NSVTYFASEF STDTPSIKEI       120
     YEVLNNYLHE PALYDKNNKA GIVVKNYGTF GPGRYLFGEY LMDES                       165
//

If you have problems or comments...

PBIL Back to PBIL home page