(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE457

CP001994.PE457       Location/Qualifiers
FT   CDS             complement(485991..487112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35995"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Z4"
FT                   /protein_id="ADE35995.1"
FT                   /translation="MEHQLVTFKKTFEDLNNLGNNSLFDFDGEKIVLLNNRTKLFFIET
FT                   LGLHDPAINFCSLGLTQIPKVALEENIKNSFEEIMHKNFVFVHKPGRTAINRFVEGLED
FT                   TKICIQADIPSNYVHFPNKYIISTEKLGTLVSMLYFREKGYIVQNPLGTYGKEGNDRPG
FT                   IDDVVAWKSPTLDELRKFRFIDKGCHISELACLRWLDRVPEPSTHLDSPVNNELILVEV
FT                   KSSKRYGLSNSPSRGVDQLLRAKKEKVAKKLFISFPTVDSDHDEVFAKIKKRMDEGPVA
FT                   GGIFFDDKGLHIHDSESFHDENVTTEIDKYESELKLVLLNNFYFNEILEMIGELDVDTD
FT                   NKGLEEVLDSFNAKIENDVSTNYLLEKLNKLIG"
     MEHQLVTFKK TFEDLNNLGN NSLFDFDGEK IVLLNNRTKL FFIETLGLHD PAINFCSLGL        60
     TQIPKVALEE NIKNSFEEIM HKNFVFVHKP GRTAINRFVE GLEDTKICIQ ADIPSNYVHF       120
     PNKYIISTEK LGTLVSMLYF REKGYIVQNP LGTYGKEGND RPGIDDVVAW KSPTLDELRK       180
     FRFIDKGCHI SELACLRWLD RVPEPSTHLD SPVNNELILV EVKSSKRYGL SNSPSRGVDQ       240
     LLRAKKEKVA KKLFISFPTV DSDHDEVFAK IKKRMDEGPV AGGIFFDDKG LHIHDSESFH       300
     DENVTTEIDK YESELKLVLL NNFYFNEILE MIGELDVDTD NKGLEEVLDS FNAKIENDVS       360
     TNYLLEKLNK LIG                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page