(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE458

CP001994.PE458       Location/Qualifiers
FT   CDS             487656..488153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0467"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR008254; KEGG: dal:Dalk_1616 hypothetical
FT                   protein; SPTR: Q8TTR5 Putative uncharacterized protein;
FT                   PFAM: Flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35996"
FT                   /db_xref="GOA:D5E9Z5"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Z5"
FT                   /protein_id="ADE35996.1"
FT                   /translation="MKTLVTYMTQTGNTKKIAEAIYGEITGEKDVKDIEDVSNLEGYDL
FT                   VFVGFPVLQFNIPEKVSNFVKENVAGKNIAFFMTHAVPEGFEAIHSWTGSCKDIAASGN
FT                   YLGTFECQGELAQPVIDMLLESDDPQMKEFGEMGPSTKGQPDESRVQKAREFAKEIQAK
FT                   VQ"
     MKTLVTYMTQ TGNTKKIAEA IYGEITGEKD VKDIEDVSNL EGYDLVFVGF PVLQFNIPEK        60
     VSNFVKENVA GKNIAFFMTH AVPEGFEAIH SWTGSCKDIA ASGNYLGTFE CQGELAQPVI       120
     DMLLESDDPQ MKEFGEMGPS TKGQPDESRV QKAREFAKEI QAKVQ                       165
//

If you have problems or comments...

PBIL Back to PBIL home page