(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE46

CP001994.PE46        Location/Qualifiers
FT   CDS             50267..51187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0047"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="COGs: COG0444 ABC-type dipeptide/oligopeptide/nickel
FT                   transport system ATPase component;
FT                   InterProIPR013563:IPR003439:IPR003593:IPR017871:IPR 010066;
FT                   KEGG: dde:Dde_1182 oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein-like; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; SPTR: Q8TIA3 Oligopeptide ABC
FT                   transporter, ATP-binding protein; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter; Oligopeptide/dipeptide transporter,
FT                   C-terminal region; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATP-binding protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35584"
FT                   /db_xref="GOA:D5E8S5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8S5"
FT                   /protein_id="ADE35584.1"
FT                   /translation="MLSIRDLKVAFESHQGPIVPVDSVDMDILDKETFTIIGESGCGKS
FT                   LLANSLLGLLPRDAQVCGKVYMDGEEILSLKEKEWRKIRGNKIGLVFQNPSASLNPVFT
FT                   MHKQLYETLKYSNKPSSRDKMVSLLKKTGIKNPLRRLPQYPHQLSGGMKQRFAIALGIA
FT                   TNPELLIADEPTNGLDVTVKLKIVEMLSKLHAERSILLITHDLNVAYNLSDKIAVMYAG
FT                   ELLEIAPAKSFFEKPIHPYSSQLLASHPEKEMIPIPGFTPQLTQRPQGCRFHPRCALAC
FT                   RKCKTEHPQLEKIDEKRYVRCFACA"
     MLSIRDLKVA FESHQGPIVP VDSVDMDILD KETFTIIGES GCGKSLLANS LLGLLPRDAQ        60
     VCGKVYMDGE EILSLKEKEW RKIRGNKIGL VFQNPSASLN PVFTMHKQLY ETLKYSNKPS       120
     SRDKMVSLLK KTGIKNPLRR LPQYPHQLSG GMKQRFAIAL GIATNPELLI ADEPTNGLDV       180
     TVKLKIVEML SKLHAERSIL LITHDLNVAY NLSDKIAVMY AGELLEIAPA KSFFEKPIHP       240
     YSSQLLASHP EKEMIPIPGF TPQLTQRPQG CRFHPRCALA CRKCKTEHPQ LEKIDEKRYV       300
     RCFACA                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page