(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE466

CP001994.PE466       Location/Qualifiers
FT   CDS             493934..494758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0475"
FT                   /product="nitrite and sulphite reductase 4Fe-4S region"
FT                   /note="COGs: COG2221 Dissimilatory sulfite reductase
FT                   (desulfoviridin) alpha and beta subunits; InterPro
FT                   IPR006066:IPR006067:IPR001450:IPR005117; KEGG:
FT                   gme:Gmet_1570 iron-sulfur cluster-binding protein; PFAM:
FT                   nitrite and sulphite reductase 4Fe-4S region; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein;
FT                   nitrite/sulfite reductase hemoprotein beta-component
FT                   ferrodoxin domain protein; SPTR: Q8TKG8 Sulfite reductase,
FT                   beta subunit; PFAM: Nitrite and sulphite reductase 4Fe-4S
FT                   domain; Nitrite/Sulfite reductase ferredoxin-like half
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36004"
FT                   /db_xref="GOA:D5EA03"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA03"
FT                   /protein_id="ADE36004.1"
FT                   /translation="MKNNGFLPQKLDNKFSMCTHLVGGCVEANQLRALTDAAEKYVAGH
FT                   VHITSRQGAEIPFVDMDDVENITEDMEDAGIFGGATGQKVRGVVACQGITVCNHGLINC
FT                   PELAARIDEIYFGTYASKKFKIAITGCPASCMKPQENDFGIMGVVRPEWIENNCVACGL
FT                   CEKICKADAISIDNGQLDIDSNSCIFCGECISSCKKSAINGAESGYAIFVGGKVGRFPR
FT                   SCDKPIEFTDENRLFSILEKTLAYYRKYGQDGERFGDLLDRRGFAEYRDTVL"
     MKNNGFLPQK LDNKFSMCTH LVGGCVEANQ LRALTDAAEK YVAGHVHITS RQGAEIPFVD        60
     MDDVENITED MEDAGIFGGA TGQKVRGVVA CQGITVCNHG LINCPELAAR IDEIYFGTYA       120
     SKKFKIAITG CPASCMKPQE NDFGIMGVVR PEWIENNCVA CGLCEKICKA DAISIDNGQL       180
     DIDSNSCIFC GECISSCKKS AINGAESGYA IFVGGKVGRF PRSCDKPIEF TDENRLFSIL       240
     EKTLAYYRKY GQDGERFGDL LDRRGFAEYR DTVL                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page