(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE467

CP001994.PE467       Location/Qualifiers
FT   CDS             complement(494764..495987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0476"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating)"
FT                   /EC_number="1.1.1.38"
FT                   /note="COGs: COG0281 Malic enzyme; InterPro
FT                   IPR012302:IPR012301; KEGG: malic enzyme; K00027 malate
FT                   dehydrogenase (oxaloacetate-decarboxylating); PFAM: malic
FT                   protein NAD-binding; malic protein domain protein; PRIAM:
FT                   Malate dehydrogenase (oxaloacetate-decarboxylating); SPTR:
FT                   Q467K6 NAD-dependent malic enzyme; PFAM: Malic enzyme, NAD
FT                   binding domain; Malic enzyme, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36005"
FT                   /db_xref="GOA:D5EA04"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA04"
FT                   /protein_id="ADE36005.1"
FT                   /translation="MKHLTVKSCMETDDSLGEESLQLHEKHHGVLEVASKVHMDNTQDL
FT                   SIAYTPGVAEPCKRIAENKDDVYKYTLKENTVAIITDGSAILGLGNIGASAGLPVMEGK
FT                   AIIFKELAGINAFPICLDTQETEEIIKTVKNIAPVFGGINLEDISAPRCFEIEERLKKE
FT                   LSIPVTHDDQHGTAIVTIAGLLNSLKLTGKKINEIKVVISGAGAAGMAIAKKLLHTGVR
FT                   PENLLVCDRHGIISKKRTEGMNPEKEKIAEFSNTEEIEGNIDDAVAGSDVFIGVSVPGI
FT                   LTEKMVASMNNDAIIFAMANPIPEIMPSKAFEAGARIVATGRSDCPNQINNCLGFPGIF
FT                   KGALETRATQINLEMELAAANALAAIVEQDGIEENYIIPNPLDKRVVPAVAKAVADAAI
FT                   KSGVARKK"
     MKHLTVKSCM ETDDSLGEES LQLHEKHHGV LEVASKVHMD NTQDLSIAYT PGVAEPCKRI        60
     AENKDDVYKY TLKENTVAII TDGSAILGLG NIGASAGLPV MEGKAIIFKE LAGINAFPIC       120
     LDTQETEEII KTVKNIAPVF GGINLEDISA PRCFEIEERL KKELSIPVTH DDQHGTAIVT       180
     IAGLLNSLKL TGKKINEIKV VISGAGAAGM AIAKKLLHTG VRPENLLVCD RHGIISKKRT       240
     EGMNPEKEKI AEFSNTEEIE GNIDDAVAGS DVFIGVSVPG ILTEKMVASM NNDAIIFAMA       300
     NPIPEIMPSK AFEAGARIVA TGRSDCPNQI NNCLGFPGIF KGALETRATQ INLEMELAAA       360
     NALAAIVEQD GIEENYIIPN PLDKRVVPAV AKAVADAAIK SGVARKK                     407
//

If you have problems or comments...

PBIL Back to PBIL home page