(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE47

CP001994.PE47        Location/Qualifiers
FT   CDS             51180..51971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0048"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1123 ATPase components of various ABC-type
FT                   transport systems contain duplicated ATPase; InterPro
FT                   IPR003439:IPR003593; KEGG: pin:Ping_0561 ABC transporter
FT                   for peptide ATP-binding protein; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase; SPTR: Q8TIA2 Oligopeptide ABC
FT                   transporter, ATP-binding protein; PFAM: ABC transporter;
FT                   Oligopeptide/dipeptide transporter, C-terminal region"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35585"
FT                   /db_xref="GOA:D5E8S6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8S6"
FT                   /protein_id="ADE35585.1"
FT                   /translation="MLEVKALDKSYSFSTIPFRKKRIKVLDNISFRINKHETLCIVGES
FT                   GCGKTTLAKCIVNLENPDNGKIILEGRDVTFPDRKTLYYLHTKVQMIFQNADTSLNPRH
FT                   HIYDSMAEPLRLQGQNEEKVRKRVFQLLDHVGLSEEHLHRHPHQLSGGQNQRIAIARAI
FT                   ALHPDLLIADEITAALDVSVQAQILQLLKTLKKEMDMTLLFISHDLALVKRIADRVAVM
FT                   QDGRLVEINDTNEIFHNPQCPYTKELISSMSQLSLDKQILK"
     MLEVKALDKS YSFSTIPFRK KRIKVLDNIS FRINKHETLC IVGESGCGKT TLAKCIVNLE        60
     NPDNGKIILE GRDVTFPDRK TLYYLHTKVQ MIFQNADTSL NPRHHIYDSM AEPLRLQGQN       120
     EEKVRKRVFQ LLDHVGLSEE HLHRHPHQLS GGQNQRIAIA RAIALHPDLL IADEITAALD       180
     VSVQAQILQL LKTLKKEMDM TLLFISHDLA LVKRIADRVA VMQDGRLVEI NDTNEIFHNP       240
     QCPYTKELIS SMSQLSLDKQ ILK                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page