(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE473

CP001994.PE473       Location/Qualifiers
FT   CDS             503026..504102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0483"
FT                   /product="L-lysine 2,3-aminomutase"
FT                   /EC_number="5.4.3.2"
FT                   /note="COGs: COG1509 Lysine 2 3-aminomutase; InterPro
FT                   IPR007197:IPR003739; KEGG: dat:HRM2_29300 YodO; PFAM:
FT                   Radical SAM domain protein; PRIAM: Lysine 2,3-aminomutase;
FT                   SPTR: Q46EP3 L-lysine 2,3-aminomutase; TIGRFAM: lysine
FT                   2,3-aminomutase YodO family protein; PFAM:
FT                   Lysine-2,3-aminomutase; TIGRFAM: KamA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36011"
FT                   /db_xref="GOA:D5EA10"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR025895"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA10"
FT                   /protein_id="ADE36011.1"
FT                   /translation="MSEEWKDQITNQINSLEKLEEIINLTESEREAIKTLDTHWGTTPY
FT                   FASLMDKDDPECPIRKQVVPSLQESHNKYGMKDYLVWKENRATEEVRPDSIARQYKDRV
FT                   AFTVFQECGIYCRHCFRKELVVSHDLKLDFNVDDGIEWIRQHPEVRDVLITGGDPLLLS
FT                   DEKIEYIIESLRDIPHVEMIRIGSRLPIVLPHRITDNLKRILGGYHDVPIWLNTQCNHP
FT                   KEITDKTKRAVYDLVSAGVNVGNQAVLLKGINDDVQTIRDLHQKLLTARIRPYYLFYCE
FT                   PAPGIDHFRTPVEKGAELIRDGLRGHTTGLAQPMYVIATNVGKIPLMPDYYMVDKDEEK
FT                   YVLRNHRGELTEIPNIPE"
     MSEEWKDQIT NQINSLEKLE EIINLTESER EAIKTLDTHW GTTPYFASLM DKDDPECPIR        60
     KQVVPSLQES HNKYGMKDYL VWKENRATEE VRPDSIARQY KDRVAFTVFQ ECGIYCRHCF       120
     RKELVVSHDL KLDFNVDDGI EWIRQHPEVR DVLITGGDPL LLSDEKIEYI IESLRDIPHV       180
     EMIRIGSRLP IVLPHRITDN LKRILGGYHD VPIWLNTQCN HPKEITDKTK RAVYDLVSAG       240
     VNVGNQAVLL KGINDDVQTI RDLHQKLLTA RIRPYYLFYC EPAPGIDHFR TPVEKGAELI       300
     RDGLRGHTTG LAQPMYVIAT NVGKIPLMPD YYMVDKDEEK YVLRNHRGEL TEIPNIPE         358
//

If you have problems or comments...

PBIL Back to PBIL home page