(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE475

CP001994.PE475       Location/Qualifiers
FT   CDS             505183..507492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0485"
FT                   /product="efflux transporter, hydrophobe/amphiphile
FT                   efflux-3 (HAE3) family"
FT                   /note="COGs: COG1033 exporter of the RND superfamily
FT                   protein; InterPro IPR003335:IPR000731:IPR004767; KEGG:
FT                   dal:Dalk_4262 cyclic nucleotide-binding protein; PFAM:
FT                   SecD/SecF/SecDF export membrane protein; SPTR: Q12TU1
FT                   Hydrophobe/amphiphile efflux-3 HAE3; TIGRFAM: efflux
FT                   transporter, hydrophobe/amphiphile efflux-3 (HAE3) family;
FT                   PFAM: MMPL family; TIGRFAM: The (Largely Archaeal Putative)
FT                   Hydrophobe/Amphiphile Efflux-3 (HAE3) Family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36013"
FT                   /db_xref="GOA:D5EA12"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004767"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA12"
FT                   /protein_id="ADE36013.1"
FT                   /translation="MLLVLVSFEGAQLIKMESGTETFVDKDSQLYQDYDHLYLSLFSKE
FT                   AIVVMVEGGDVQDRALLEAIDRLDRMSSSIPGVLSTQSASSVVKEANKLENGRFEIPQN
FT                   DEQFSELIPYIPSSLSPDKTHTLVYIEMAGDTSEVRKQEILSEVETSVDLAEFPPGYNF
FT                   IVTGDPAFEIGMNKEMMSSMGILLLLSAFLMVIVLYLVFRHVRWRLMPLAIVLLGIIYT
FT                   FGAMGYLGIPMTMVSMAAFPVLIGLGIDYAIQFHNRIEEELERGESPREAVIDTIKHTG
FT                   PAVMIALTITSLGFVSLATSTVPMVQDFAKLLLIGVFMCFLSSLFVGVTVIYGLDTFAK
FT                   KKQEKAKKHRVDSLRHRLITRRFKKPDKKQTSTDSGGFIDNTLRSVATFTMKHPVPVLI
FT                   IAGLICVNGLYTDTFVPIQTDTETFVPEDMPALIDLQHLGDITGGDDELNVIIKTSNIA
FT                   DPDLLQWVDKFSQHEVDNRDNVYAATSLVSLIKDNNGGVLPDSEAGVKHVLSEIPDSAK
FT                   ERYISGQNIMVVNLNIGDAMSGLGLEGIETLANVIENDIQWLAPPPDVSVTITGHSFVF
FT                   IEVIGALTSGRIFMTYLGLGMVFAGLLVIYRDFLKAFVPVITMFMVIGWTGGLMYYLNM
FT                   EYTPMTATLGALILGVGSEYAVLMMERYFEEREKGALPEAAMCEASVKIGKAIVTSGLT
FT                   TLFGFLALVASAFGIISSFGIITVIDVALALIATFVIFPPVIVTLDKWRDKHRAKKAGH
FT                   NMNSSANYLQTGADIS"
     MLLVLVSFEG AQLIKMESGT ETFVDKDSQL YQDYDHLYLS LFSKEAIVVM VEGGDVQDRA        60
     LLEAIDRLDR MSSSIPGVLS TQSASSVVKE ANKLENGRFE IPQNDEQFSE LIPYIPSSLS       120
     PDKTHTLVYI EMAGDTSEVR KQEILSEVET SVDLAEFPPG YNFIVTGDPA FEIGMNKEMM       180
     SSMGILLLLS AFLMVIVLYL VFRHVRWRLM PLAIVLLGII YTFGAMGYLG IPMTMVSMAA       240
     FPVLIGLGID YAIQFHNRIE EELERGESPR EAVIDTIKHT GPAVMIALTI TSLGFVSLAT       300
     STVPMVQDFA KLLLIGVFMC FLSSLFVGVT VIYGLDTFAK KKQEKAKKHR VDSLRHRLIT       360
     RRFKKPDKKQ TSTDSGGFID NTLRSVATFT MKHPVPVLII AGLICVNGLY TDTFVPIQTD       420
     TETFVPEDMP ALIDLQHLGD ITGGDDELNV IIKTSNIADP DLLQWVDKFS QHEVDNRDNV       480
     YAATSLVSLI KDNNGGVLPD SEAGVKHVLS EIPDSAKERY ISGQNIMVVN LNIGDAMSGL       540
     GLEGIETLAN VIENDIQWLA PPPDVSVTIT GHSFVFIEVI GALTSGRIFM TYLGLGMVFA       600
     GLLVIYRDFL KAFVPVITMF MVIGWTGGLM YYLNMEYTPM TATLGALILG VGSEYAVLMM       660
     ERYFEEREKG ALPEAAMCEA SVKIGKAIVT SGLTTLFGFL ALVASAFGII SSFGIITVID       720
     VALALIATFV IFPPVIVTLD KWRDKHRAKK AGHNMNSSAN YLQTGADIS                   769
//

If you have problems or comments...

PBIL Back to PBIL home page