(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE476

CP001994.PE476       Location/Qualifiers
FT   CDS             507489..508589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0486"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q12TU0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36014"
FT                   /db_xref="GOA:D5EA13"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA13"
FT                   /protein_id="ADE36014.1"
FT                   /translation="MSRIQNNTINFRRPLVFLSLISLILLATLFSGMSTAQSKEYIPPT
FT                   YEYTTNYYRGYGMPDIHASVVGDTHFERGETATLNVILSNRGILHGFKSVTDVEGDKAE
FT                   QALAMKELEYETKRTIAYGIKTRLVSPTDYIEIDSSTNGQALEKLVPGDLPSRPMTFTI
FT                   EISDDAPAGDYVLFLPVSYEYQEDVRMTGGRTIQLGLPEMDHATYYNNSNKTLQIPIHI
FT                   EKAAQFEVVDVAGDLVAGEDRVIQVTYRNVGELTADGALARVVVMDPLSTGSSTALLGT
FT                   LEPGEEHTVSFNVNSDVMAVVKDYAIDSEIRYIDEDGDYAFSENMKINVPLQSSGEWIG
FT                   ITQVSLLLTFLITIYLIVDSIRKKKK"
     MSRIQNNTIN FRRPLVFLSL ISLILLATLF SGMSTAQSKE YIPPTYEYTT NYYRGYGMPD        60
     IHASVVGDTH FERGETATLN VILSNRGILH GFKSVTDVEG DKAEQALAMK ELEYETKRTI       120
     AYGIKTRLVS PTDYIEIDSS TNGQALEKLV PGDLPSRPMT FTIEISDDAP AGDYVLFLPV       180
     SYEYQEDVRM TGGRTIQLGL PEMDHATYYN NSNKTLQIPI HIEKAAQFEV VDVAGDLVAG       240
     EDRVIQVTYR NVGELTADGA LARVVVMDPL STGSSTALLG TLEPGEEHTV SFNVNSDVMA       300
     VVKDYAIDSE IRYIDEDGDY AFSENMKINV PLQSSGEWIG ITQVSLLLTF LITIYLIVDS       360
     IRKKKK                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page