(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE477

CP001994.PE477       Location/Qualifiers
FT   CDS             508613..509710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0487"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR008162; SPTR: Q12TT9 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36015"
FT                   /db_xref="GOA:D5EA14"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA14"
FT                   /protein_id="ADE36015.1"
FT                   /translation="MNKRNLIIGIIALGISLICLIPASAAGFSPQNDALPDYFDFSDNY
FT                   YTAYGGPDVSATIVGDNEFYRGDSVTLNINLMNKGVITGFRSEKDDDPVDVLDQKLQQE
FT                   EMSYESQRTTAIGIVAILTSPDPNVEVKSGPQEAGSLATGEQTTSPVKFNIDFSNNAPS
FT                   GDYPLILSLYYGYQKNVQVSGDNETSLGVTNMDVGLWYDVGSQNVTIPVNVKREAQFEV
FT                   TNVSGQLAVGEEGMLHVTYTNTGNEPVKDAIVRISAANPFSTTDDQAYLGDLDAGESAV
FT                   AVFKLKVGDSAVEKPYAINSEIKYEDTKGHDRVSDNVKIKTQVSASSNTYTGGLMLPAG
FT                   FAIAALVIGAIVLYMRRKPGQKPEE"
     MNKRNLIIGI IALGISLICL IPASAAGFSP QNDALPDYFD FSDNYYTAYG GPDVSATIVG        60
     DNEFYRGDSV TLNINLMNKG VITGFRSEKD DDPVDVLDQK LQQEEMSYES QRTTAIGIVA       120
     ILTSPDPNVE VKSGPQEAGS LATGEQTTSP VKFNIDFSNN APSGDYPLIL SLYYGYQKNV       180
     QVSGDNETSL GVTNMDVGLW YDVGSQNVTI PVNVKREAQF EVTNVSGQLA VGEEGMLHVT       240
     YTNTGNEPVK DAIVRISAAN PFSTTDDQAY LGDLDAGESA VAVFKLKVGD SAVEKPYAIN       300
     SEIKYEDTKG HDRVSDNVKI KTQVSASSNT YTGGLMLPAG FAIAALVIGA IVLYMRRKPG       360
     QKPEE                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page