(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE483

CP001994.PE483       Location/Qualifiers
FT   CDS             512863..513171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0493"
FT                   /product="SSU ribosomal protein S24E"
FT                   /note="COGs: COG2004 Ribosomal protein S24E; InterPro
FT                   IPR001976; KEGG: similar to ribosomal protein S24e; K02974
FT                   small subunit ribosomal protein S24e; PFAM: Ribosomal
FT                   protein S24e; SPTR: Q12TT3 30S ribosomal protein S24e;
FT                   PFAM: Ribosomal protein S24e"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36021"
FT                   /db_xref="GOA:D5EA20"
FT                   /db_xref="InterPro:IPR001976"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA20"
FT                   /protein_id="ADE36021.1"
FT                   /translation="MDISIIEEKNNTLLNRKELKFNVTFEGPTPARNDIKSKLAAMLNV
FT                   PVELIIVQGMRNMFGKQELSGNARIYEDASRMKRVEKEYNLKRNELPETEAEEASEE"
     MDISIIEEKN NTLLNRKELK FNVTFEGPTP ARNDIKSKLA AMLNVPVELI IVQGMRNMFG        60
     KQELSGNARI YEDASRMKRV EKEYNLKRNE LPETEAEEAS EE                          102
//

If you have problems or comments...

PBIL Back to PBIL home page