(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE486

CP001994.PE486       Location/Qualifiers
FT   CDS             complement(513719..515986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0496"
FT                   /product="signal transduction histidine kinase"
FT                   /note="COGs: COG3920 Signal transduction histidine kinase;
FT                   InterProIPR013655:IPR011495:IPR003594:IPR003660:IPR
FT                   000700:IPR005467; KEGG: ppd:Ppro_3009 hypothetical protein;
FT                   PFAM: histidine kinase dimerisation/phosphoacceptor; PAS
FT                   fold-3 domain protein; ATP-binding region ATPase domain
FT                   protein; histidine kinase HAMP region domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; SPTR:
FT                   Q12XN1 Multisensor signal transduction histidine kinase;
FT                   PFAM: Histidine kinase; Cache domain; Histidine kinase-,
FT                   DNA gyrase B-, and HSP90-like ATPase; PAS fold"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36024"
FT                   /db_xref="GOA:D5EA23"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA23"
FT                   /protein_id="ADE36024.1"
FT                   /translation="MIEMTWKDVPLKSKLMFFILMGILVVLITSTAVIISTVTTQEEDL
FT                   AYQQSIQKAKNYANQFDIEMRSNQATGQAIAHSLSQYHSENRTEVNNILLKLLEENPDL
FT                   LGTYVCFEPNAFDGMDSRYVNTTGHDETGRFIPYWNRIPGNITLDPLLDYDTSVYYQLP
FT                   KEIKKDIVTEPYYYEGVFIVSYVTPVMRGGEFIGIGGVDVSLNHLNGVVNNVKAFDTGY
FT                   AIMTGNTGILISHPTNEELVGAKTLYDYGVPEITRMADEIKLGKSGYIETIDPITGKDV
FT                   VMFYEPIKTSKFAFILVVPKDEMLAGVTDLRNRLLLISSISLIFMGAIAILITRSVTGP
FT                   INEIVNDFKNISDAAIGGKLDERAETDVDIDFREIPEGLNDILNALENASQLREEMEKV
FT                   VNNSPVIVFKWKAEKNWPVEFVSKNISQFGYSPEDFGPNGLDYGDIIHPDDLPGVETKL
FT                   GEICSGKETQFNIEYRILTKDGETRWVDERTFIQRNQREIIHNMINKDNDIDSQVSDLK
FT                   GKCHDVKYLQGVIVNIDERKQAEEALLKIEDIRKKEIHHRIKNNLQVISTLLYLESEKF
FT                   KDDDVLDAFNNSRDRVRTMALVHEKLYQSKDMESIDFSDYSKNLINYLSQSYVLEKSEV
FT                   DIKINVENIFLGMDTAVPLGIIINELVSNSLKYAFDKGKGTIIVELRKINDHHKLVVSD
FT                   NGIGMKDEIDFEDTDSLGLLLVHTLAEQINATIEIDTSKGTKFEITFQEKNQELREGED
FT                   VR"
     MIEMTWKDVP LKSKLMFFIL MGILVVLITS TAVIISTVTT QEEDLAYQQS IQKAKNYANQ        60
     FDIEMRSNQA TGQAIAHSLS QYHSENRTEV NNILLKLLEE NPDLLGTYVC FEPNAFDGMD       120
     SRYVNTTGHD ETGRFIPYWN RIPGNITLDP LLDYDTSVYY QLPKEIKKDI VTEPYYYEGV       180
     FIVSYVTPVM RGGEFIGIGG VDVSLNHLNG VVNNVKAFDT GYAIMTGNTG ILISHPTNEE       240
     LVGAKTLYDY GVPEITRMAD EIKLGKSGYI ETIDPITGKD VVMFYEPIKT SKFAFILVVP       300
     KDEMLAGVTD LRNRLLLISS ISLIFMGAIA ILITRSVTGP INEIVNDFKN ISDAAIGGKL       360
     DERAETDVDI DFREIPEGLN DILNALENAS QLREEMEKVV NNSPVIVFKW KAEKNWPVEF       420
     VSKNISQFGY SPEDFGPNGL DYGDIIHPDD LPGVETKLGE ICSGKETQFN IEYRILTKDG       480
     ETRWVDERTF IQRNQREIIH NMINKDNDID SQVSDLKGKC HDVKYLQGVI VNIDERKQAE       540
     EALLKIEDIR KKEIHHRIKN NLQVISTLLY LESEKFKDDD VLDAFNNSRD RVRTMALVHE       600
     KLYQSKDMES IDFSDYSKNL INYLSQSYVL EKSEVDIKIN VENIFLGMDT AVPLGIIINE       660
     LVSNSLKYAF DKGKGTIIVE LRKINDHHKL VVSDNGIGMK DEIDFEDTDS LGLLLVHTLA       720
     EQINATIEID TSKGTKFEIT FQEKNQELRE GEDVR                                  755
//

If you have problems or comments...

PBIL Back to PBIL home page