(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE487

CP001994.PE487       Location/Qualifiers
FT   CDS             complement(515997..516776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0497"
FT                   /product="Domain of unknown function DUF1724"
FT                   /note="COGs: COG4742 transcriptional regulator protein;
FT                   InterPro IPR013561; PFAM: Domain of unknown function
FT                   DUF1724; SPTR: Q8PSW7 Conserved protein; PFAM: Domain of
FT                   unknown function (DUF1724)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36025"
FT                   /db_xref="InterPro:IPR013561"
FT                   /db_xref="InterPro:IPR016490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA24"
FT                   /protein_id="ADE36025.1"
FT                   /translation="MQSSLSDTIWLSEKRKRLLLLLMEGPRNIDQIKTSLNVTSKAMMP
FT                   QIKILKEQNLIIEEDRVYQLSDIGEIIVKNMVPLLKTLGVIEENNDYWATRDLSSIPEE
FT                   LDSRLGDIGECMVIEPDMNHLFDLPEEFSKNLIKSQKVMTIMAYFHPLYPDLYYELAND
FT                   GVQIDLILTEPIYKRMKEEYTDKFRHIVEREHTNLYICNEVNLTSVVTDRFIYLCLFNK
FT                   NDMYDHKKIMSFDASALQWGTELYEHFRQKSTLIEWD"
     MQSSLSDTIW LSEKRKRLLL LLMEGPRNID QIKTSLNVTS KAMMPQIKIL KEQNLIIEED        60
     RVYQLSDIGE IIVKNMVPLL KTLGVIEENN DYWATRDLSS IPEELDSRLG DIGECMVIEP       120
     DMNHLFDLPE EFSKNLIKSQ KVMTIMAYFH PLYPDLYYEL ANDGVQIDLI LTEPIYKRMK       180
     EEYTDKFRHI VEREHTNLYI CNEVNLTSVV TDRFIYLCLF NKNDMYDHKK IMSFDASALQ       240
     WGTELYEHFR QKSTLIEWD                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page