(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE496

CP001994.PE496       Location/Qualifiers
FT   CDS             526219..527211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0507"
FT                   /product="metalloendopeptidase, glycoprotease family"
FT                   /EC_number="3.4.24.57"
FT                   /note="COGs: COG0533 Metal-dependent protease with possible
FT                   chaperone activity; InterPro IPR017861:IPR000905; KEGG:
FT                   similar to Osgep-prov protein; K01409 O-sialoglycoprotein
FT                   endopeptidase; PFAM: peptidase M22 glycoprotease; PRIAM:
FT                   O-sialoglycoprotein endopeptidase; SPTR: Q12WQ7 Putative
FT                   O-sialoglycoprotein endopeptidase; TIGRFAM:
FT                   metalloendopeptidase, glycoprotease family; PFAM:
FT                   Glycoprotease family; TIGRFAM: metalloendopeptidase,
FT                   putative, glycoprotease family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36034"
FT                   /db_xref="GOA:D5EA33"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022449"
FT                   /db_xref="InterPro:IPR034680"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA33"
FT                   /protein_id="ADE36034.1"
FT                   /translation="MTLVLGIEGTAWNLSAAVVNEDEVVCEVTHTYKPTTGGIHPREAA
FT                   QHHAQFASWVISNLFGELAEKNINPKDIDAISFSQGPGLGACLRTVATAARALSLSLEI
FT                   PLVGVNHCVAHVEIGRWKTPAKDPVVLYASGANTQVLAYRRGKYRVFGETLDIGVGNAL
FT                   DKFARSAGLSHPGGPQIEMYAKDSVNYVNLPYVVKGMDFSFSGLSTAATDALQKHTLED
FT                   VCYSLQENAFAMLVEVTERALAHTGKNEVLLGGGVGANMRLREMLDIMCDDRGASFYVP
FT                   EKRFMGDNGAMIAWLGLLMYKAGDTIRVDDSHVNPNYRPDMVDVTWLKE"
     MTLVLGIEGT AWNLSAAVVN EDEVVCEVTH TYKPTTGGIH PREAAQHHAQ FASWVISNLF        60
     GELAEKNINP KDIDAISFSQ GPGLGACLRT VATAARALSL SLEIPLVGVN HCVAHVEIGR       120
     WKTPAKDPVV LYASGANTQV LAYRRGKYRV FGETLDIGVG NALDKFARSA GLSHPGGPQI       180
     EMYAKDSVNY VNLPYVVKGM DFSFSGLSTA ATDALQKHTL EDVCYSLQEN AFAMLVEVTE       240
     RALAHTGKNE VLLGGGVGAN MRLREMLDIM CDDRGASFYV PEKRFMGDNG AMIAWLGLLM       300
     YKAGDTIRVD DSHVNPNYRP DMVDVTWLKE                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page