(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE497

CP001994.PE497       Location/Qualifiers
FT   CDS             527217..527786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0508"
FT                   /product="Mn2+dependent serine/threonine protein kinase"
FT                   /note="COGs: COG3642 Mn2+-dependent serine/threonine
FT                   protein kinase; InterPro IPR018934:IPR000719; KEGG: similar
FT                   to TP53-regulating kinase (p53-related protein kinase)
FT                   (Nori-2); K08851 TP53 regulating kinase; PFAM: RIO-like
FT                   kinase; SPTR: Q12WQ8 O-sialoglycoprotein endopeptidase;
FT                   PFAM: RIO1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36035"
FT                   /db_xref="GOA:D5EA34"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022495"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA34"
FT                   /protein_id="ADE36035.1"
FT                   /translation="MLRDGAEATVIRRNNRLVKSRIPKRYRVRELDERIRRERTRAEAR
FT                   LISEARRAGVATPVIYDIYNSIIEMDYIDGKPLKYVISETLCEKLGELVGRLHSAGIIH
FT                   GDLTTSNVIWDGSKMWLIDFGLAFSAEDLESRGVDIHVLFQTLESSHPNHEVLIDAFCK
FT                   GYYRTLESAKDVLERVIEIETRGRYA"
     MLRDGAEATV IRRNNRLVKS RIPKRYRVRE LDERIRRERT RAEARLISEA RRAGVATPVI        60
     YDIYNSIIEM DYIDGKPLKY VISETLCEKL GELVGRLHSA GIIHGDLTTS NVIWDGSKMW       120
     LIDFGLAFSA EDLESRGVDI HVLFQTLESS HPNHEVLIDA FCKGYYRTLE SAKDVLERVI       180
     EIETRGRYA                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page