(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE498

CP001994.PE498       Location/Qualifiers
FT   CDS             527854..528408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0509"
FT                   /product="dITPase"
FT                   /EC_number="3.6.1.-"
FT                   /EC_number="3.6.1.15"
FT                   /note="COGs: COG0127 Xanthosine triphosphate
FT                   pyrophosphatase; InterPro IPR002637; KEGG: DNA
FT                   repair-related protein; PFAM: Ham1 family protein; SPTR:
FT                   Q8PZ91 Nucleoside-triphosphatase; TIGRFAM: non-canonical
FT                   purine NTP pyrophosphatase, rdgB/HAM1 family; PFAM: Ham1
FT                   family; TIGRFAM: non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36036"
FT                   /db_xref="GOA:D5EA35"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA35"
FT                   /protein_id="ADE36036.1"
FT                   /translation="MRKIVFVTGNSGKFREIKAILEKRGIEVLQNTDGYPELQEDDLEP
FT                   IAADGARLSCEKLGLSVMVDDSGLFIDALNGFPGPYSAFVEDHLGNPKVLKLMEDEENR
FT                   RAYFKSVIGYCEPGKEPLTFTGIVEGNIGYEEKGKGGFGYDPIFLYGDRTFGEMGDEEK
FT                   NKVSHRKRAVDKFVEWIDSNL"
     MRKIVFVTGN SGKFREIKAI LEKRGIEVLQ NTDGYPELQE DDLEPIAADG ARLSCEKLGL        60
     SVMVDDSGLF IDALNGFPGP YSAFVEDHLG NPKVLKLMED EENRRAYFKS VIGYCEPGKE       120
     PLTFTGIVEG NIGYEEKGKG GFGYDPIFLY GDRTFGEMGD EEKNKVSHRK RAVDKFVEWI       180
     DSNL                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page